RegulonDB RegulonDB 10.9: Gene Form
   

slp gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

insH11 slp dctR MarA GadX GadX YdeO GadX GadW GadX GadX GadW slpp slpp insHp4 insHp4 insHp3 insHp3 TSS_4112 TSS_4112

Gene      
Name: slp    Texpresso search in the literature
Synonym(s): ECK3490, EG11890, b3506
Genome position(nucleotides): 3653961 --> 3654527 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
45.86
Reference(s): [1] Alexander DM., et al., 1994
External database links:  
ASAP:
ABE-0011451
CGSC:
33726
ECHOBASE:
EB1836
ECOLIHUB:
slp
OU-MICROARRAY:
b3506
STRING:
511145.b3506
COLOMBOS: slp


Product      
Name: starvation lipoprotein
Synonym(s): Slp
Sequence: Get amino acid sequence Fasta Format
Cellular location: outer membrane
Molecular weight: 20.964
Isoelectric point: 7.585
Motif(s):
 
Type Positions Sequence
16 -> 165 LAACSSIPQNIKGNNQPDIQKSFVAVHNQPGLYVGQQARFGGKVINVINGKTDTLLEISVLPLDSYAKPDIEANYQGRLLARQSGFLDPVNYRNHFVTILGTIQGEQPGFINKVPYNFLEVNMQGIQVWHLREVVNTTYNLWDYGYGAFW
19 -> 188 CSSIPQNIKGNNQPDIQKSFVAVHNQPGLYVGQQARFGGKVINVINGKTDTLLEISVLPLDSYAKPDIEANYQGRLLARQSGFLDPVNYRNHFVTILGTIQGEQPGFINKVPYNFLEVNMQGIQVWHLREVVNTTYNLWDYGYGAFWPEPGWGAPYYTNAVSQVTPELVK
1 -> 18 MNMTKGALILSLSFLLAA

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.5 - adaptations --> 5.5.3 - starvation
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
GO:0019867 - outer membrane
GO:0016020 - membrane
molecular_function GO:0042802 - identical protein binding
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG11890-MONOMER
ECOLIWIKI:
b3506
INTERPRO:
IPR004658
PANTHER:
PTHR37530
PFAM:
PF03843
PRIDE:
P37194
PRODB:
PRO_000023955
PROSITE:
PS51257
REFSEQ:
NP_417963
UNIPROT:
P37194


Operon      
Name: slp-dctR         
Operon arrangement:
Transcription unit        Promoter
slp-dctR


Transcriptional Regulation      
Display Regulation             
Activated by: GadX, GadE-RcsB, YdeO
Repressed by: MarA, H-NS, GadW


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4112 3653189 reverse nd [RS-EPT-CBR] [2]
  promoter insHp3 3653268 reverse Similarity to the consensus
Read more >
[ICWHO], [RS-EPT-CBR] [2], [3]
  promoter insHp4 3653269 reverse Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Alexander DM., St John AC., 1994, Characterization of the carbon starvation-inducible and stationary phase-inducible gene slp encoding an outer membrane lipoprotein in Escherichia coli., Mol Microbiol 11(6):1059-71

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB