RegulonDB RegulonDB 10.9: Gene Form
   

rcbA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

xisR rcbA ralR ralA terminator ralAp ralAp intRp4 intRp4

Gene      
Name: rcbA    Texpresso search in the literature
Synonym(s): ECK1344, EG11901, b1347, ydaC
Genome position(nucleotides): 1413531 <-- 1413740 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
34.76
External database links:  
ASAP:
ABE-0004522
ECHOBASE:
EB1846
ECOLIHUB:
ydaC
OU-MICROARRAY:
b1347
STRING:
511145.b1347
COLOMBOS: rcbA


Product      
Name: Rac prophage; double-strand break reduction protein
Synonym(s): RcbA, YdaC
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 7.863
Isoelectric point: 10.233
Motif(s):
 
Type Positions Sequence
2 -> 62 YKITATIEKEGGTPTNWTRYSKSKLTKSECEKMLSGKKEAGVSREQKVKLINFNCEKLQSS
9 -> 69 EKEGGTPTNWTRYSKSKLTKSECEKMLSGKKEAGVSREQKVKLINFNCEKLQSSRIALYSN
1 -> 1 M

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.1 - DNA related
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
molecular_function GO:0005515 - protein binding
biological_process GO:0006259 - DNA metabolic process
GO:0046677 - response to antibiotic
Note(s): Note(s): ...[more].
Evidence: [IGI] Inferred from genetic interaction
[IMP] Inferred from mutant phenotype
Reference(s): [1] Felczak MM., et al., 2012
External database links:  
DIP:
DIP-11619N
ECOCYC:
EG11901-MONOMER
ECOLIWIKI:
b1347
INTERPRO:
IPR009572
PFAM:
PF06688
PRIDE:
P33230
REFSEQ:
NP_415863
UNIPROT:
P33230


Operon      
Name: recET-ralR-rcbA-xisR-intR         
Operon arrangement:
Transcription unit        Promoter
recET-ralR-rcbA-xisR-intR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter intRp4 1413260 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Felczak MM., Kaguni JM., 2012, The rcbA gene product reduces spontaneous and induced chromosome breaks in Escherichia coli., J Bacteriol 194(9):2152-64

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB