RegulonDB RegulonDB 11.1: Gene Form

rcbA gene in Escherichia coli K-12 genome

Gene local context to scale (view description)

xisR rcbA ralR ralA Rac prophage;  antitoxin RalA terminator ralAp ralAp intRp4 intRp4

Name: rcbA    Texpresso search in the literature
Synonym(s): ECK1344, EG11901, b1347, ydaC
Genome position(nucleotides): 1413531 <-- 1413740
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
External database links:  

Name: Rac prophage; double-strand break reduction protein
Synonym(s): RcbA, YdaC
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 7.863
Isoelectric point: 10.233
Type Positions Sequence Comment
1 -> 1 M UniProt: No protein should be translated, DNA region still acts as an antitoxin to RalR..
9 -> 69 EKEGGTPTNWTRYSKSKLTKSECEKMLSGKKEAGVSREQKVKLINFNCEKLQSSRIALYSN UniProt: No protein should be translated, DNA region still acts as an antitoxin to RalR..


Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.1 - DNA related
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
molecular_function GO:0005515 - protein binding
biological_process GO:0006259 - DNA metabolic process
GO:0046677 - response to antibiotic
Note(s): Note(s): ...[more].
Evidence: [EXP-IGI] Inferred from genetic interaction
[EXP-IMP] Inferred from mutant phenotype
Reference(s): [1] Felczak MM., et al., 2012
External database links:  

Name: recET-ralR-rcbA-xisR-intR         
Operon arrangement:
Transcription unit        Promoter

Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter intRp4 1413260 reverse nd [COMP-AINF] [2]


 [COMP-AINF] Inferred computationally without human oversight


 [1] Felczak MM., Kaguni JM., 2012, The rcbA gene product reduces spontaneous and induced chromosome breaks in Escherichia coli., J Bacteriol 194(9):2152-64

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78
