RegulonDB RegulonDB 10.8: Gene Form
   

yjbM gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dusA yjbM yjbL terminator anti-terminator anti-anti-terminator dusAp6 dusAp6 dusAp9 dusAp9 TSS_4886 TSS_4886 TSS_4885 TSS_4885

Gene      
Name: yjbM    Texpresso search in the literature
Synonym(s): ECK4040, EG11931, b4048
Genome position(nucleotides): 4260599 --> 4261306 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
36.58
External database links:  
ASAP:
ABE-0013255
ECHOBASE:
EB1875
OU-MICROARRAY:
b4048
PortEco:
yjbM
STRING:
511145.b4048
COLOMBOS: yjbM


Product      
Name: DUF2713 domain-containing protein YjbM
Synonym(s): YjbM
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 26.673
Isoelectric point: 4.24
Motif(s):
 
Type Positions Sequence
1 -> 235 MWVNKYIDDCTDEDLNDRDFIASVVDRAIFHFAINSICNPGDNKDAMPIEQCTFDVETKNDLPSTVQLFYEESKDNEPLANIHFQAIGSGFLTFVNACQEHDDNSLKLFASLLISLSYSSAYADLSETVYINENNESYLKAQFEKLSQRDMKKYLGEMKRLADGGEMNFDGYLDKMSHLVNEGTLDPDILSKMRDAAPQLISFAKSFDPTSKEEIKILTDTSKLIYDLFGVKSEK

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG11931-MONOMER
ECOLIWIKI:
b4048
INTERPRO:
IPR020404
PFAM:
PF10897
PRIDE:
P32694
PRODOM:
PD116985
REFSEQ:
NP_418472
UNIPROT:
P32694


Operon      
Name: yjbLM         
Operon arrangement:
Transcription unit        Promoter
 


Regulation by small RNA    
  Display Regulation
small RNA gcvB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4885 4261470 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4886 4261594 forward nd [RS-EPT-CBR] [1]
  promoter dusAp9 4261600 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter dusAp6 4261658 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB