RegulonDB RegulonDB 10.9: Gene Form
   

yjbQ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

aphA yjbQ yjbR GadE terminator anti-terminator TSS_4895 TSS_4895 TSS_4894 TSS_4894 TSS_4893 TSS_4893 yjbQp yjbQp

Gene      
Name: yjbQ    Texpresso search in the literature
Synonym(s): ECK4048, EG11935, b4056
Genome position(nucleotides): 4270238 --> 4270654 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.8
External database links:  
ASAP:
ABE-0013286
ECHOBASE:
EB1879
ECOLIHUB:
yjbQ
OU-MICROARRAY:
b4056
STRING:
511145.b4056
COLOMBOS: yjbQ


Product      
Name: UPF0047 protein YjbQ
Synonym(s): YjbQ
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 15.656
Isoelectric point: 7.029
Motif(s):
 
Type Positions Sequence
19 -> 133 VTDEILNQLADMPRVNIGLLHLLLQHTSASLTLNENCDPTVRHDMERFFLRTVPDNGNYEHDYEGADDMPSHIKSSMLGTSLVLPVHKGRIQTGTWQGIWLGEHRIHGGSRRIIA

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-48208N
ECOCYC:
EG11935-MONOMER
ECOLIWIKI:
b4056
INTERPRO:
IPR001602
INTERPRO:
IPR035917
PANTHER:
PTHR30615
PFAM:
PF01894
PRIDE:
P0AF48
PROSITE:
PS01314
REFSEQ:
NP_418480
SMR:
P0AF48
UNIPROT:
P0AF48


Operon      
Name: yjbQR         
Operon arrangement:
Transcription unit        Promoter
yjbQR


Transcriptional Regulation      
Display Regulation             
Activated by: GadE


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4893 4270219 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4894 4270273 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4895 4270712 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB