RegulonDB RegulonDB 10.9: Gene Form
   

yjbR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

uvrA yjbQ yjbR TSS_4896 TSS_4896 TSS_4895 TSS_4895 TSS_4894 TSS_4894

Gene      
Name: yjbR    Texpresso search in the literature
Synonym(s): ECK4049, EG11936, b4057
Genome position(nucleotides): 4270658 --> 4271014 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.42
External database links:  
ASAP:
ABE-0013288
ECHOBASE:
EB1880
ECOLIHUB:
yjbR
OU-MICROARRAY:
b4057
STRING:
511145.b4057
COLOMBOS: yjbR


Product      
Name: PF04237 family protein YjbR
Synonym(s): YjbR
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 13.519
Isoelectric point: 6.517
Motif(s):
 
Type Positions Sequence
10 -> 10 C
68 -> 68 R
12 -> 101 AKPGAEQSVHNDWKATQIKVEDVLFAMVKEVENRPAVSLKTSPELAELLRQQHSDVRPSRHLNKAHWSTVYLDGSLPDSQIYYLVDASYQ

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG11936-MONOMER
ECOLIWIKI:
b4057
INTERPRO:
IPR038056
INTERPRO:
IPR007351
MODBASE:
P0AF50
PANTHER:
PTHR35145
PDB:
2FKI
PFAM:
PF04237
PRIDE:
P0AF50
REFSEQ:
NP_418481
SMR:
P0AF50
SWISSMODEL:
P0AF50
UNIPROT:
P0AF50


Operon      
Name: yjbQR         
Operon arrangement:
Transcription unit        Promoter
yjbQR


Transcriptional Regulation      
Display Regulation             
Activated by: GadE


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4894 4270273 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4895 4270712 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4896 4273337 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB