RegulonDB RegulonDB 10.8: Gene Form
   

nrfC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: nrfC    Texpresso search in the literature
Synonym(s): ECK4065, EG11946, b4072, yjcJ
Genome position(nucleotides): 4289808 --> 4290479 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
57.89
External database links:  
ASAP:
ABE-0013346
CGSC:
34352
ECHOBASE:
EB1889
OU-MICROARRAY:
b4072
PortEco:
nrfC
STRING:
511145.b4072
COLOMBOS: nrfC


Product      
Name: putative menaquinol-cytochrome c reductase 4Fe-4S subunit
Synonym(s): NrfC, YjcJ
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 24.567
Isoelectric point: 8.624
Motif(s):
 
Type Positions Sequence
1 -> 27 MTWSRRQFLTGVGVLAAVSGTAGRVVA
65 -> 66 GV
83 -> 114 VKYRFFRKSCQHCDHAPCVDVCPTGASFRDAA
28 -> 223 KTLNINGVRYGMVHDESLCIGCTACMDACREVNKVPEGVSRLTIIRSEPQGEFPDVKYRFFRKSCQHCDHAPCVDVCPTGASFRDAASGIVDVNPDLCVGCQYCIAACPYRVRFIHPVTKTADKCDFCRKTNLQAGKLPACVEACPTKALTFGNLDDPNSEISQLLRQKPTYRYKLALGTKPKLYRVPFKYGEVSQ
37 -> 65 YGMVHDESLCIGCTACMDACREVNKVPEG

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.7 - anaerobic respiration
  1 - metabolism --> 1.4 - energy production/transport --> 1.4.2 - electron acceptors
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0005887 - integral component of plasma membrane
molecular_function GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
GO:0042279 - nitrite reductase (cytochrome, ammonia-forming) activity
biological_process GO:0019645 - anaerobic electron transport chain
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
NRFC-MONOMER
ECOLIWIKI:
b4072
INTERPRO:
IPR017900
INTERPRO:
IPR019546
INTERPRO:
IPR017896
INTERPRO:
IPR017567
INTERPRO:
IPR006311
MODBASE:
P0AAK7
PFAM:
PF13247
PFAM:
PF00037
PRIDE:
P0AAK7
PRODB:
PRO_000023413
PROSITE:
PS00198
PROSITE:
PS51318
PROSITE:
PS51379
REFSEQ:
NP_418496
SMR:
P0AAK7
UNIPROT:
P0AAK7


Operon      
Name: nrfABCDEFG         
Operon arrangement:
Transcription unit        Promoter
nrfABCDEFG


Transcriptional Regulation      
Display Regulation             
Activated by: FNR, IHF, NarL, NarP, FlhDC
Repressed by: NsrR, IHF, NarL, Fis


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB