RegulonDB RegulonDB 10.8: Gene Form
   

mtlR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mtlA mtlD mtlR yibT Fis TSS_4181 TSS_4181 TSS_4180 TSS_4180 TSS_4179 TSS_4179

Gene      
Name: mtlR    Texpresso search in the literature
Synonym(s): ECK3590, EG11965, b3601
Genome position(nucleotides): 3775572 --> 3776159 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.02
Note(s): There are several palindrome sequences within mtlR gene that may work to regulate transcription or translation Figge RM,1994
External database links:  
ASAP:
ABE-0011769
CGSC:
36774
ECHOBASE:
EB1908
OU-MICROARRAY:
b3601
PortEco:
mtlR
STRING:
511145.b3601
COLOMBOS: mtlR


Product      
Name: transcriptional repressor MtlR
Synonym(s): MtlR, repressor for mtl
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 21.99
Isoelectric point: 4.444
Motif(s):
 
Type Positions Sequence
29 -> 187 ENRVLERLNAGKTVRSFLITAVELLTEAVNLLVLQVFRKDDYAVKYAVEPLLDGDGPLGDLSVRLKLIYGLGVINRQEYEDAELLMALREELNHDGNEYAFTDDEILGPFGELHCVAALPPPPQFEPADSSLYAMQIQRYQQAVRSTMVLSLTELISKI

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
biological_process GO:0045892 - negative regulation of transcription, DNA-templated
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Choe M., et al., 2017
[2] Figge RM., et al., 1994
[3] Jiang W., et al., 1990
[4] Sofia HJ., et al., 1994
External database links:  
ECOCYC:
PD00369
ECOLIWIKI:
b3601
INTERPRO:
IPR007761
INTERPRO:
IPR038026
PANTHER:
PTHR37941
PFAM:
PF05068
PRIDE:
P0AF10
PRODB:
PRO_000023305
REFSEQ:
NP_418058
SMR:
P0AF10
UNIPROT:
P0AF10


Operon      
Name: mtlADR         
Operon arrangement:
Transcription unit        Promoter
mtlADR


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: Cra, Fis


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4179 3774405 forward nd [RS-EPT-CBR] [5]
  promoter TSS_4180 3774416 forward nd [RS-EPT-CBR] [5]
  promoter TSS_4181 3774432 forward nd [RS-EPT-CBR] [5]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Choe M., Park YH., Lee CR., Kim YR., Seok YJ., 2017, The general PTS component HPr determines the preference for glucose over mannitol., Sci Rep 7:43431

 [2] Figge RM., Ramseier TM., Saier MH., 1994, The mannitol repressor (MtlR) of Escherichia coli., J Bacteriol 176(3):840-7

 [3] Jiang W., Wu LF., Tomich J., Saier MH., Niehaus WG., 1990, Corrected sequence of the mannitol (mtl) operon in Escherichia coli., Mol Microbiol 4(11):2003-6

 [4] Sofia HJ., Burland V., Daniels DL., Plunkett G., Blattner FR., 1994, Analysis of the Escherichia coli genome. V. DNA sequence of the region from 76.0 to 81.5 minutes., Nucleic Acids Res 22(13):2576-86

 [5] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB