RegulonDB RegulonDB 10.9: Gene Form
   

yhdN gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

zntR rplQ yhdN anti-terminator terminator TSS_3614 TSS_3614 TSS_3613 TSS_3613 TSS_3612 TSS_3612 TSS_3611 TSS_3611 yhdNp yhdNp zntRp2 zntRp2

Gene      
Name: yhdN    Texpresso search in the literature
Synonym(s): ECK3280, EG11970, b3293
Genome position(nucleotides): 3439141 <-- 3439509 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.97
External database links:  
ASAP:
ABE-0010795
ECHOBASE:
EB1913
ECOLIHUB:
yhdN
OU-MICROARRAY:
b3293
STRING:
511145.b3293
COLOMBOS: yhdN


Product      
Name: DUF1992 domain-containing protein YhdN
Synonym(s): YhdN
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 13.945
Isoelectric point: 4.673
Motif(s):
 
Type Positions Sequence
7 -> 72 WAERHIAEAQAKGEFDNLAGSGEPLILDDDSHVPPELRAGYRLLKNAGCLPPELEQRREAIQLLDI

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG11970-MONOMER
ECOLIWIKI:
b3293
INTERPRO:
IPR018961
PFAM:
PF09350
PRIDE:
P36677
REFSEQ:
NP_417752
SMR:
P36677
UNIPROT:
P36677


Operon      
Name: yhdN-zntR         
Operon arrangement:
Transcription unit        Promoter
yhdN-zntR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter zntRp2 3439168 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_3611 3439845 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3612 3439858 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3613 3439992 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3614 3439994 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB