RegulonDB RegulonDB 10.10: Gene Form
   

nupC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mntH nupC insL3 CRP CRP OxyR OxyR Fur MntR terminator TSS_2678 TSS_2678 insLp5 insLp5 nupCp nupCp mntHp mntHp

Gene      
Name: nupC    Texpresso search in the literature
Synonym(s): ECK2388, EG11971, b2393, cru
Genome position(nucleotides): 2513042 --> 2514244 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.88
External database links:  
ASAP:
ABE-0007893
CGSC:
443
ECHOBASE:
EB1914
ECOLIHUB:
nupC
OU-MICROARRAY:
b2393
STRING:
511145.b2393
COLOMBOS: nupC


Product      
Name: nucleoside:H+ symporter NupC
Synonym(s): Cru, NupC, NupC nucleoside NUP transporter
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 43.476
Isoelectric point: 8.829
Motif(s):
 
Type Positions Sequence
251 -> 271 IIVAAMLIGFIALIAALNALF
379 -> 399 LKLVYGSTLVSVLSASIAALV
282 -> 302 ISFQGILGYIFYPIAWVMGVP
88 -> 88 A
92 -> 189 LKVLCPIVFISALIGILQHIRVLPVIIRAIGFLLSKVNGMGKLESFNAVSSLILGQSENFIAYKDILGKISRNRMYTMAATAMSTVSMSIVGAYMTML

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.33 - nucleotide and nucleoside conversions
  4 - transport --> 4.2 - Electrochemical potential driven transporters --> 4.2.A - Porters (Uni-, Sym- and Antiporters)
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0015506 - nucleoside:proton symporter activity
biological_process GO:1901642 - nucleoside transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [1] Komatsu Y. 1973
[2] Mulinta R., et al., 2017
[3] Tong M., et al., 2020
[4] Vasilca V., et al., 2018
[5] Zhang Y., et al., 1992
External database links:  
ECOCYC:
NUPC-MONOMER
ECOLIWIKI:
b2393
INTERPRO:
IPR018270
INTERPRO:
IPR011657
INTERPRO:
IPR011642
INTERPRO:
IPR008276
INTERPRO:
IPR002668
PANTHER:
PTHR10590
PFAM:
PF01773
PFAM:
PF07662
PFAM:
PF07670
PRIDE:
P0AFF2
PRODB:
PRO_000023442
REFSEQ:
NP_416894
SMR:
P0AFF2
UNIPROT:
P0AFF2


Operon      
Name: nupC         
Operon arrangement:
Transcription unit        Promoter
nupC


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, Nac
Repressed by: CytR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter insLp5 2514322 forward nd [ICWHO] [6]
  promoter TSS_2678 2514349 forward nd [RS-EPT-CBR] [7]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Komatsu Y., 1973, Adenosine uptake by isolated membrane vesicles from Escherichia coli K-12., Biochim Biophys Acta 330(2):206-21

 [2] Mulinta R., Yao SYM., Ng AML., Cass CE., Young JD., 2017, Substituted cysteine accessibility method (SCAM) analysis of the transport domain of human concentrative nucleoside transporter 3 (hCNT3) and other family members reveals features of structural and functional importance., J Biol Chem 292(23):9505-9522

 [3] Tong M., French S., El Zahed SS., Ong WK., Karp PD., Brown ED., 2020, Gene Dispensability in Escherichia coli Grown in Thirty Different Carbon Environments., mBio 11(5)

 [4] Vasilca V., Sadeghpour A., Rawson S., Hawke LE., Baldwin SA., Wilkinson T., Bannister D., Postis VLG., Rappolt M., Muench SP., Jeuken LJC., 2018, Spherical-supported membranes as platforms for screening against membrane protein targets., Anal Biochem 549:58-65

 [5] Zhang Y., Craig JE., Gallagher MP., 1992, Location of the nupC gene on the physical map of Escherichia coli K-12., J Bacteriol 174(17):5758-9

 [6] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [7] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB