RegulonDB RegulonDB 10.9: Gene Form
   

fliQ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fliR fliP fliQ RcsAB

Gene      
Name: fliQ    Texpresso search in the literature
Synonym(s): ECK1947, EG11976, b1949, flaQ
Genome position(nucleotides): 2022616 --> 2022885 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.37
External database links:  
ASAP:
ABE-0006477
CGSC:
760
ECHOBASE:
EB1919
ECOLIHUB:
fliQ
OU-MICROARRAY:
b1949
STRING:
511145.b1949
COLOMBOS: fliQ


Product      
Name: flagellar biosynthesis protein FliQ
Synonym(s): FlaQ, FliQ, flagellar biosynthetic protein FliQ
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,cell projection
Molecular weight: 9.632
Isoelectric point: 4.584
Motif(s):
 
Type Positions Sequence
55 -> 75 IIAVFIAIIIAGPWMLNLLLD
16 -> 40 VALALAAPLLLVALVTGLIISILQA
6 -> 77 VMMMGTEAMKVALALAAPLLLVALVTGLIISILQAATQINEMTLSFIPKIIAVFIAIIIAGPWMLNLLLDYV

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.11 - glycoprotein
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.12 - flagellum
  6 - cell structure --> 6.4 - flagella
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
GO:0009288 - bacterial-type flagellum
GO:0009425 - bacterial-type flagellum basal body
biological_process GO:0009306 - protein secretion
GO:0044780 - bacterial-type flagellum assembly
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG11976-MONOMER
ECOLIWIKI:
b1949
INTERPRO:
IPR006305
INTERPRO:
IPR002191
PANTHER:
PTHR34040
PFAM:
PF01313
PRIDE:
P0AC07
PRINTS:
PR00952
REFSEQ:
NP_416459
SMR:
P0AC07
UNIPROT:
P0AC07


Operon      
Name: fliLMNOPQR         
Operon arrangement:
Transcription unit        Promoter
fliLMNOPQR
fliLMNOPQR


Transcriptional Regulation      
Display Regulation             
Activated by: FlhDC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB