RegulonDB RegulonDB 10.9: Gene Form
   

rfbA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rfbX rfbD rfbA rfbC terminator TSS_2389 (cluster) TSS_2389 (cluster) rfbXp7 rfbXp7 rfbXp8 rfbXp8 rfbXp5 rfbXp5 rfbXp6 rfbXp6 TSS_2388 TSS_2388

Gene      
Name: rfbA    Texpresso search in the literature
Synonym(s): ECK2033, EG11978, b2039, rmlA, som
Genome position(nucleotides): 2110138 <-- 2111019 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
42.74
External database links:  
ASAP:
ABE-0006762
CGSC:
297
ECHOBASE:
EB1921
ECOLIHUB:
rfbA
OU-MICROARRAY:
b2039
STRING:
511145.b2039
COLOMBOS: rfbA


Product      
Name: dTDP-glucose pyrophosphorylase
Synonym(s): RfbA, RmlA, Som
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 32.694
Isoelectric point: 5.207
Motif(s):
 
Type Positions Sequence
247 -> 247 Q
5 -> 241 KGIILAGGSGTRLYPVTMAVSKQLLPIYDKPMIYYPLSTLMLAGIRDILIISTPQDTPRFQQLLGDGSQWGLNLQYKVQPSPDGLAQAFIIGEEFIGGDDCALVLGDNIFYGHDLPKLMEAAVNKESGATVFAYHVNDPERYGVVEFDKNGTAISLEEKPLEPKSNYAVTGLYFYDNDVVQMAKNLKPSARGELEITDINRIYLEQGRLSVAMMGRGYAWLDTGTHQSLIEASNFIA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.3 - lipopolysaccharide --> 1.6.3.1 - O antigen
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.10 - sugar nucleotide biosynthesis, conversions
  6 - cell structure --> 6.3 - surface antigens (ECA, O antigen of LPS)
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016779 - nucleotidyltransferase activity
GO:0016740 - transferase activity
GO:0046872 - metal ion binding
GO:0008879 - glucose-1-phosphate thymidylyltransferase activity
GO:0042802 - identical protein binding
biological_process GO:0009058 - biosynthetic process
GO:0009103 - lipopolysaccharide biosynthetic process
GO:0009243 - O antigen biosynthetic process
GO:0045226 - extracellular polysaccharide biosynthetic process
GO:0019305 - dTDP-rhamnose biosynthetic process
External database links:  
ECOCYC:
DTDPGLUCOSEPP-MONOMER
ECOLIWIKI:
b2039
INTERPRO:
IPR005907
INTERPRO:
IPR005835
INTERPRO:
IPR029044
MODBASE:
P37744
PANTHER:
PTHR43532
PDB:
1H5T
PDB:
1H5S
PDB:
1H5R
PFAM:
PF00483
PRIDE:
P37744
PRODB:
PRO_000023783
REFSEQ:
NP_416543
SMR:
P37744
UNIPROT:
P37744


Operon      
Name: rfbBDACX         
Operon arrangement:
Transcription unit        Promoter
rfbACX
rfbBDACX


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2388 2108494 reverse nd [RS-EPT-CBR] [1]
  promoter rfbXp6 2109586 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter rfbXp5 2109676 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter rfbXp8 2109716 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter rfbXp7 2109718 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_2389 (cluster) 2111073 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB