RegulonDB RegulonDB 10.9: Gene Form
   

yehI gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yehI yehH yehF yehK yehKp1 yehKp1

Gene      
Name: yehI    Texpresso search in the literature
Synonym(s): ECK2109, EG11995, b2118
Genome position(nucleotides): 2200279 --> 2203911 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.78
External database links:  
ASAP:
ABE-0007003
ECHOBASE:
EB1936
ECOLIHUB:
yehI
OU-MICROARRAY:
b2118
STRING:
511145.b2118
COLOMBOS: yehI


Product      
Name: DUF4132 domain-containing protein YehI
Synonym(s): YehI
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 138.067
Isoelectric point: 6.634
Motif(s):
 
Type Positions Sequence
954 -> 1138 RQKSVPRLRADDDQLKAPEALARLKGLKKDATQVSKNLLPRLETALRTTRRWSLADFHSLFVNHPFTRLVTQRLIWGVYPANEPRCLLKAFRVAAEGEFCNAQDEPIDLPADALIGIAHPLEMTAEMRSEFAQLFADYEIMPPFRQLSRRTVLLTPDESTSNSLTRWEGKSATVGQLMGMRYKGW

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG11995-MONOMER
ECOLIWIKI:
b2118
INTERPRO:
IPR025406
PFAM:
PF13569
PRIDE:
P33346
REFSEQ:
NP_416621
UNIPROT:
P33346


Operon      
Name: yehHI         
Operon arrangement:
Transcription unit        Promoter
yehHI


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yehKp1 2203784 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB