RegulonDB RegulonDB 10.9: Gene Form
   

yehP gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yehM yehQ yehP yehL yehR

Gene      
Name: yehP    Texpresso search in the literature
Synonym(s): ECK2113, EG12002, b2121
Genome position(nucleotides): 2207967 --> 2209103 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.35
External database links:  
ASAP:
ABE-0007013
ECHOBASE:
EB1940
ECOLIHUB:
yehP
OU-MICROARRAY:
b2121
STRING:
511145.b2121
COLOMBOS: yehP


Product      
Name: VWA domain-containing protein YehP
Synonym(s): YehP
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 42.119
Isoelectric point: 6.351
Motif(s):
 
Type Positions Sequence
151 -> 372 LAKEVRQAFSGVRDRRRRSFIPLARNFDFKSTLRANLQHWHPQHGKLYIESPRFNSRIKRQSEQWQLVLLVDQSGSMVDSVIHSAVMAACLWQLPGIRTHLVAFDTSVVDLTADVADPVELLMKVQLGGGTNIASAVEYGRQLIEQPAKSVIILVSDFYEGGSSSLLTHQVKKCVQSGIKVLGLAALDSTATPCYDRDTAQALVNVGAQIAAMTPGELASWL

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.3 - motility, chemotaxis, energytaxis (aerotaxis, redoxtaxis etc)
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
biological_process GO:0071978 - bacterial-type flagellum-dependent swarming motility
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG12002-MONOMER
ECOLIWIKI:
b2121
INTERPRO:
IPR002035
INTERPRO:
IPR008912
INTERPRO:
IPR036465
MODBASE:
P33352
PFAM:
PF05762
PRIDE:
P33352
REFSEQ:
NP_416625
SMART:
SM00327
UNIPROT:
P33352


Operon      
Name: yehLMPQ         
Operon arrangement:
Transcription unit        Promoter
yehLMPQ


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB