RegulonDB RegulonDB 10.9: Gene Form
   

btsR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

btsS mlrA btsR yehS FliZ yohOp6 yohOp6 mlrAp mlrAp mlrAp9 mlrAp9 mlrAp6 mlrAp6 TSS_2443 TSS_2443 TSS_2442 TSS_2442

Gene      
Name: btsR    Texpresso search in the literature
Synonym(s): ECK2117, EG12006, b2125, yehT
Genome position(nucleotides): 2212243 <-- 2212962 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.31
External database links:  
ASAP:
ABE-0007023
ECHOBASE:
EB1944
ECOLIHUB:
yehT
OU-MICROARRAY:
b2125
STRING:
511145.b2125
COLOMBOS: btsR


Product      
Name: DNA-binding transcriptional dual regulator BtsR
Synonym(s): BtsR, YehT
Sequence: Get amino acid sequence Fasta Format
Regulator Family: LytTR
Cellular location: cytosol
Molecular weight: 27.4
Isoelectric point: 6.173
Motif(s):
 
Type Positions Sequence
3 -> 116 KVLIVDDEPLARENLRVFLQEQSDIEIVGECSNAVEGIGAVHKLRPDVLFLDIQMPRISGLEMVGMLDPEHRPYIVFLTAFDEYAIKAFEEHAFDYLLKPIDEARLEKTLARLR
4 -> 112 VLIVDDEPLARENLRVFLQEQSDIEIVGECSNAVEGIGAVHKLRPDVLFLDIQMPRISGLEMVGMLDPEHRPYIVFLTAFDEYAIKAFEEHAFDYLLKPIDEARLEKTL
137 -> 239 IPCTGHSRIYLLQMKDVAFVSSRMSGVYVTSHEGKEGFTELTLRTLESRTPLLRCHRQYLVNLAHLQEIRLEDNGQAELILRNGLTVPVSRRYLKSLKEAIGL
54 -> 54 D
144 -> 237 RIYLLQMKDVAFVSSRMSGVYVTSHEGKEGFTELTLRTLESRTPLLRCHRQYLVNLAHLQEIRLEDNGQAELILRNGLTVPVSRRYLKSLKEAI

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level
  5 - cell processes --> 5.6 - protection --> 5.6.4 - drug resistance/sensitivity
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0032993 - protein-DNA complex
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0003700 - DNA-binding transcription factor activity
GO:0000156 - phosphorelay response regulator activity
GO:0000976 - transcription regulatory region sequence-specific DNA binding
GO:0001216 - DNA-binding transcription activator activity
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0045893 - positive regulation of transcription, DNA-templated
GO:0000160 - phosphorelay signal transduction system
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
[IMP] Inferred from mutant phenotype
Reference(s): [1] Hirakawa H., et al., 2003
[2] Hirakawa H., et al., 2003
External database links:  
DIP:
DIP-48085N
ECOCYC:
EG12006-MONOMER
ECOLIWIKI:
b2125
INTERPRO:
IPR001789
INTERPRO:
IPR007492
INTERPRO:
IPR011006
MODBASE:
P0AFT5
PFAM:
PF04397
PFAM:
PF00072
PRIDE:
P0AFT5
PROSITE:
PS50930
PROSITE:
PS50110
REFSEQ:
NP_416629
SMART:
SM00850
SMART:
SM00448
SMR:
P0AFT5
SWISSMODEL:
P0AFT5
UNIPROT:
P0AFT5


Operon      
Name: btsSR         
Operon arrangement:
Transcription unit        Promoter
btsSR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2442 2212969 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2443 2214673 reverse nd [RS-EPT-CBR] [3]
  promoter mlrAp6 2214749 forward Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter mlrAp9 2214785 forward Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter yohOp6 2215586 forward Similarity to the consensus
Read more >
[ICWHO] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Hirakawa H., Nishino K., Hirata T., Yamaguchi A., 2003, Comprehensive studies of drug resistance mediated by overexpression of response regulators of two-component signal transduction systems in Escherichia coli., J Bacteriol 185(6):1851-6

 [2] Hirakawa H., Nishino K., Yamada J., Hirata T., Yamaguchi A., 2003, Beta-lactam resistance modulated by the overexpression of response regulators of two-component signal transduction systems in Escherichia coli., J Antimicrob Chemother 52(4):576-82

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB