RegulonDB RegulonDB 10.9: Gene Form
   

yehX gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yehY yehX osmF yehW yohO

Gene      
Name: yehX    Texpresso search in the literature
Synonym(s): ECK2122, EG12010, b2129
Genome position(nucleotides): 2216481 <-- 2217407 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.12
External database links:  
ASAP:
ABE-0007034
ECHOBASE:
EB1948
ECOLIHUB:
yehX
OU-MICROARRAY:
b2129
STRING:
511145.b2129
COLOMBOS: yehX


Product      
Name: glycine betaine ABC transporter ATP binding subunit YehX
Synonym(s): YehX
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,cytosol
Molecular weight: 34.424
Isoelectric point: 6.249
Motif(s):
 
Type Positions Sequence
18 -> 162 NDLNLNFQEGSFSVLIGTSGSGKSTTLKMINRLVEHDSGEIRFAGEEIRSLPVLELRRRMGYAIQSIGLFPHWSVAQNIATVPQLQKWSRARIDDRIDELMALLGLESNLRERYPHQLSGGQQQRVGVARALAADPQVLLMDEPF
2 -> 235 IEFSHVSKLFGAQKAVNDLNLNFQEGSFSVLIGTSGSGKSTTLKMINRLVEHDSGEIRFAGEEIRSLPVLELRRRMGYAIQSIGLFPHWSVAQNIATVPQLQKWSRARIDDRIDELMALLGLESNLRERYPHQLSGGQQQRVGVARALAADPQVLLMDEPFGALDPVTRGALQQEMTRIHRLLGRTIVLVTHDIDEALRLAEHLVLMDHGEVVQQGNPLTMLTRPANDFVRQFF
34 -> 41 GTSGSGKS

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.a - ABC superfamily ATP binding cytoplasmic component
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0055052 - ATP-binding cassette (ABC) transporter complex, substrate-binding subunit-containing
molecular_function GO:0016887 - ATPase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0031459 - ATPase-coupled glycine betaine transporter activity
biological_process GO:0006865 - amino acid transport
GO:0031460 - glycine betaine transport
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11912N
ECOCYC:
YEHX-MONOMER
ECOLIWIKI:
b2129
INTERPRO:
IPR027417
INTERPRO:
IPR003593
INTERPRO:
IPR003439
INTERPRO:
IPR017871
MODBASE:
P33360
PFAM:
PF00005
PRIDE:
P33360
PROSITE:
PS50893
PROSITE:
PS00211
REFSEQ:
NP_416633
SMART:
SM00382
SMR:
P33360
UNIPROT:
P33360


Operon      
Name: osmF-yehYXW         
Operon arrangement:
Transcription unit        Promoter
osmF-yehYXW
osmF-yehYXW


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB