RegulonDB RegulonDB 10.8: Gene Form
   

yohC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pbpG yohC yohD terminator yohDp2 yohDp2 yohCp3 yohCp3 yohCp4 yohCp4 TSS_2452 TSS_2452 pbpGp5 pbpGp5 pbpGp7 pbpGp7

Gene      
Name: yohC    Texpresso search in the literature
Synonym(s): ECK2128, EG12016, b2135
Genome position(nucleotides): 2225044 <-- 2225631 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.57
External database links:  
ASAP:
ABE-0007053
ECHOBASE:
EB1953
OU-MICROARRAY:
b2135
PortEco:
yohC
STRING:
511145.b2135
COLOMBOS: yohC


Product      
Name: putative inner membrane protein
Synonym(s): YohC
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 21.691
Isoelectric point: 7.629
Motif(s):
 
Type Positions Sequence
33 -> 55 VLLMAAIPVICAFIGTTQIGWNF
170 -> 192 LAIGVLVLEVLLALTVILWGYGY
65 -> 87 WFTGLALAVLFYGVMLAGVAVMG
135 -> 157 VGTVALFYTGYLLYLGIPSFLNI
7 -> 177 LFSHPDREMQVINRENETISHHYTHHVLLMAAIPVICAFIGTTQIGWNFGDGTILKLSWFTGLALAVLFYGVMLAGVAVMGRVIWWMARNYPQRPSLAHCMVFAGYVATPLFLSGLVALYPLVWLCALVGTVALFYTGYLLYLGIPSFLNINKEEGLSFSSSTLAIGVLVL

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
biological_process GO:0006974 - cellular response to DNA damage stimulus
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG12016-MONOMER
ECOLIWIKI:
b2135
INTERPRO:
IPR009698
PFAM:
PF06930
PRIDE:
P0AD17
REFSEQ:
NP_416639
UNIPROT:
P0AD17


Operon      
Name: yohC         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter pbpGp7 2224941 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter pbpGp5 2225066 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_2452 2225664 reverse nd [RS-EPT-CBR] [2]
  promoter yohCp4 2225669 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yohCp3 2225679 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yohDp2 2225763 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB