RegulonDB RegulonDB 10.9: Gene Form
   

yohJ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dusC cdd yohK yohJ NsrR CRP CytR CytR CRP CRP terminator sanAp3 sanAp3 cddp cddp TSS_2454 TSS_2454 yohJp yohJp yohJp4 yohJp4 dusCp dusCp

Gene      
Name: yohJ    Texpresso search in the literature
Synonym(s): ECK2134, EG12023, b2141
Genome position(nucleotides): 2230624 --> 2231022 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.37
External database links:  
ASAP:
ABE-0007078
ECHOBASE:
EB1958
ECOLIHUB:
yohJ
OU-MICROARRAY:
b2141
STRING:
511145.b2141
COLOMBOS: yohJ


Product      
Name: PF03788 family membrane protein YohJ
Synonym(s): YohJ
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 14.579
Isoelectric point: 9.18
Motif(s):
 
Type Positions Sequence
23 -> 113 YAGIFIASLLPVTIPGSIIGMLILFVLLALQILPAKWVNPGCYVLIRYMALLFVPIGVGVMQYFDLLRAQFGPVVVSCAVSTLVVFLVVSW
63 -> 83 GCYVLIRYMALLFVPIGVGVM
7 -> 27 IIWQYLRAFVLIYACLYAGIF
31 -> 51 LLPVTIPGSIIGMLILFVLLA
93 -> 113 FGPVVVSCAVSTLVVFLVVSW

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG12023-MONOMER
ECOLIWIKI:
b2141
INTERPRO:
IPR005538
INTERPRO:
IPR022957
PANTHER:
PTHR33931
PFAM:
PF03788
PRIDE:
P60632
REFSEQ:
NP_416646
UNIPROT:
P60632


Operon      
Name: yohJK         
Operon arrangement:
Transcription unit        Promoter
yohJK


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yohJp4 2230493 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_2454 2230603 forward nd [RS-EPT-CBR] [2]
  promoter sanAp3 2232684 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB