RegulonDB RegulonDB 10.9: Gene Form
   

yohK gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dusC cdd yohK yohJ NsrR CRP CytR CytR CRP CRP terminator sanAp3 sanAp3 cddp cddp TSS_2454 TSS_2454 yohJp yohJp yohJp4 yohJp4 dusCp dusCp

Gene      
Name: yohK    Texpresso search in the literature
Synonym(s): ECK2135, EG12024, b2142
Genome position(nucleotides): 2231019 --> 2231714 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.45
External database links:  
ASAP:
ABE-0007080
ECHOBASE:
EB1959
ECOLIHUB:
yohK
OU-MICROARRAY:
b2142
STRING:
511145.b2142
COLOMBOS: yohK


Product      
Name: PF04712 family membrane protein YohK
Synonym(s): YohK
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 24.469
Isoelectric point: 9.502
Motif(s):
 
Type Positions Sequence
119 -> 139 IAASILPKSVTTPIAMAVGGS
12 -> 224 TLIVFFAARKLAARYKFPLLNPLLVAMVVIIPFLMLTGISYDSYFKGSEVLNDLLQPAVVALAYPLYEQLHQIRARWKSIITICFIGSVVAMVTGTSVALLMGASPEIAASILPKSVTTPIAMAVGGSIGGIPAISAVCVIFVGILGAVFGHTLLNAMRIRTKAARGLAMGTASHALGTARCAELDYQEGAFSSLALVLCGIITSLIAPFLFP
91 -> 111 IITICFIGSVVAMVTGTSVAL
2 -> 22 MANIWWSLPLTLIVFFAARKL
30 -> 50 LLNPLLVAMVVIIPFLMLTGI

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.9.B - Putative uncharacterized transport protein
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
Reference(s): [1] Paradis-Bleau C., et al., 2014
External database links:  
ECOCYC:
EG12024-MONOMER
ECOLIWIKI:
b2142
INTERPRO:
IPR005261
INTERPRO:
IPR007300
PANTHER:
PTHR30249
PFAM:
PF04172
PRIDE:
P0AD19
REFSEQ:
NP_416647
UNIPROT:
P0AD19


Operon      
Name: yohJK         
Operon arrangement:
Transcription unit        Promoter
yohJK


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yohJp4 2230493 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_2454 2230603 forward nd [RS-EPT-CBR] [3]
  promoter sanAp3 2232684 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Paradis-Bleau C., Kritikos G., Orlova K., Typas A., Bernhardt TG., 2014, A genome-wide screen for bacterial envelope biogenesis mutants identifies a novel factor involved in cell wall precursor metabolism., PLoS Genet 10(1):e1004056

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB