RegulonDB RegulonDB 10.8: Gene Form
   

sanA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

cdd sanA yeiS terminator anti-terminator anti-anti-terminator sanAp3 sanAp3

Gene      
Name: sanA    Texpresso search in the literature
Synonym(s): ECK2137, EG12025, b2144, sfiXSt, yeiF
Genome position(nucleotides): 2232878 --> 2233597 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.78
External database links:  
ASAP:
ABE-0007091
ECHOBASE:
EB1960
OU-MICROARRAY:
b2144
PortEco:
sanA
STRING:
511145.b2144
COLOMBOS: sanA


Product      
Name: DUF218 domain-containing protein SanA
Synonym(s): SanA, YeiF
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space,inner membrane
Molecular weight: 27.287
Isoelectric point: 9.458
Motif(s):
 
Type Positions Sequence
156 -> 239 IALHMGIQAQCYAVPSPKDMLSVRIREFAARFGALADLYIFKREPRFLGPLVPIPAMHQVPEDAQGYPAVTPEQLLELQKKQGK
7 -> 23 LSLLVLIGLLLLTVLGL
48 -> 170 GVVLGTAKYYRTGVINQYYRYRIQGAINAYNSGKVNYLLLSGDNALQSYNEPMTMRKDLIAAGVDPSDIVLDYAGFRTLDSIVRTRKVFDTNDFIIITQRFHCERALFIALHMGIQAQCYAVP

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0030288 - outer membrane-bounded periplasmic space
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
biological_process GO:0042493 - response to drug
GO:0090549 - response to carbon starvation
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG12025-MONOMER
ECOLIWIKI:
b2144
INTERPRO:
IPR003848
INTERPRO:
IPR023604
PFAM:
PF02698
PRIDE:
P0AFY2
PRODB:
PRO_000023903
REFSEQ:
NP_416649
SMR:
P0AFY2
UNIPROT:
P0AFY2


Operon      
Name: sanA-yeiS         
Operon arrangement:
Transcription unit        Promoter
 


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter sanAp3 2232684 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB