RegulonDB RegulonDB 10.9: Gene Form
   

yeiH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yeiH yeiE nfo SoxS SoxS Rob MarA terminator yeiIp2 yeiIp2 nfop nfop yeiEp5 yeiEp5 TSS_2461 TSS_2461 yeiHp7 yeiHp7 yeiEp6 yeiEp6 TSS_2460 TSS_2460 yeiEp7 yeiEp7 TSS_2459 TSS_2459

Gene      
Name: yeiH    Texpresso search in the literature
Synonym(s): ECK2151, EG12027, b2158
Genome position(nucleotides): 2249717 --> 2250766 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.05
External database links:  
ASAP:
ABE-0007142
ECHOBASE:
EB1962
ECOLIHUB:
yeiH
OU-MICROARRAY:
b2158
STRING:
511145.b2158
COLOMBOS: yeiH


Product      
Name: PF03601 family inner membrane protein YeiH
Synonym(s): YeiH
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 36.882
Isoelectric point: 9.736
Motif(s):
 
Type Positions Sequence
36 -> 58 IPAVAGAGFSALTLAILLGMVLG
13 -> 32 LWHFIPGLALSAVITGVALW
18 -> 326 PGLALSAVITGVALWGGSIPAVAGAGFSALTLAILLGMVLGNTIYPHIWKSCDGGVLFAKQYLLRLGIILYGFRLTFSQIADVGISGIIIDVLTLSSTFLLACFLGQKVFGLDKHTSWLIGAGSSICGAAAVLATEPVVKAEASKVTVAVATVVIFGTVAIFLYPAIYPLMSQWFSPETFGIYIGSTVHEVAQVVAAGHAISPDAENAAVISKMLRVMMLAPFLILLAARVKQLSGANSGEKSKITIPWFAILFIVVAIFNSFHLLPQSVVNMLVTLDTFLLAMAMAALGLTTHVSALKKAGAKPLLMA
163 -> 185 VTVAVATVVIFGTVAIFLYPAIY
132 -> 151 HTSWLIGAGSSICGAAAVLA

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG12027-MONOMER
ECOLIWIKI:
b2158
INTERPRO:
IPR018383
INTERPRO:
IPR004630
PANTHER:
PTHR30106
PFAM:
PF03601
PRIDE:
P62723
REFSEQ:
NP_416663
UNIPROT:
P62723


Operon      
Name: yeiH         
Operon arrangement:
Transcription unit        Promoter
yeiH


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2459 2249471 reverse nd [RS-EPT-CBR] [1]
  promoter yeiEp7 2249638 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_2460 2249642 reverse nd [RS-EPT-CBR] [1]
  promoter yeiEp6 2249656 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yeiHp7 2249666 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_2461 2249700 forward nd [RS-EPT-CBR] [1]
  promoter yeiEp5 2249711 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yeiIp2 2251653 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB