RegulonDB RegulonDB 10.9: Gene Form
   

yeiP gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yeiQ yeiP yeiW setB CRP terminator terminator anti-terminator anti-anti-terminator yeiQp6 yeiQp6 yeiQp5 yeiQp5 TSS_2470 TSS_2470 TSS_2469 TSS_2469 yeiWp6 yeiWp6 TSS_2468 TSS_2468 yeiPp yeiPp TSS_2467 (cluster) TSS_2467 (cluster) yeiWp7 yeiWp7 yeiWp yeiWp

Gene      
Name: yeiP    Texpresso search in the literature
Synonym(s): ECK2165, EG12035, b2171
Genome position(nucleotides): 2265450 --> 2266022 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.91
External database links:  
ASAP:
ABE-0007187
ECHOBASE:
EB1970
ECOLIHUB:
yeiP
OU-MICROARRAY:
b2171
STRING:
511145.b2171
COLOMBOS: yeiP


Product      
Name: elongation factor P-like protein YeiP
Synonym(s): YeiP
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 21.533
Isoelectric point: 4.635
Motif(s):
 
Type Positions Sequence
133 -> 188 VDLEIVETAPGIKGASASARNKPATLSTGLVIQVPEYLSPGEKIRIHIEERRYMGR
4 -> 62 ANEIKKGMVLNYNGKLLLVKDIDIQSPTARGAATLYKMRFSDVRTGLKVEERFKGDDIV
72 -> 124 VDFSYVDGNEYVFMDKEDYTPYTFTKDQIEEELLFMPEGGMPDMQVLTWDGQL

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003746 - translation elongation factor activity
biological_process GO:0006414 - translational elongation
GO:0043043 - peptide biosynthetic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG12035-MONOMER
ECOLIWIKI:
b2171
INTERPRO:
IPR011897
INTERPRO:
IPR001059
INTERPRO:
IPR008991
INTERPRO:
IPR020599
INTERPRO:
IPR012340
INTERPRO:
IPR013185
INTERPRO:
IPR013852
INTERPRO:
IPR014722
INTERPRO:
IPR015365
MODBASE:
P0A6N8
PANTHER:
PTHR30053
PFAM:
PF08207
PFAM:
PF09285
PFAM:
PF01132
PRIDE:
P0A6N8
PROSITE:
PS01275
REFSEQ:
NP_416676
SMART:
SM00841
SMART:
SM01185
SMR:
P0A6N8
UNIPROT:
P0A6N8


Operon      
Name: yeiP         
Operon arrangement:
Transcription unit        Promoter
yeiP


Transcriptional Regulation      
Display Regulation             
Activated by: CRP


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yeiWp7 2265413 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_2467 (cluster) 2265414 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_2468 2265420 forward nd [RS-EPT-CBR] [2]
  promoter yeiWp6 2265420 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_2469 2265428 forward nd [RS-EPT-CBR] [2]
  promoter TSS_2470 2265434 forward nd [RS-EPT-CBR] [2]
  promoter yeiQp5 2266164 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yeiQp6 2266214 forward Similarity to the consensus
Read more >
[ICWHO], [RS-EPT-CBR] [1], [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB