RegulonDB RegulonDB 10.9: Gene Form
   

yeiQ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yeiQ yeiR yeiP terminator TSS_2472 TSS_2472 yeiRp3 yeiRp3 yeiQp6 yeiQp6 yeiQp5 yeiQp5

Gene      
Name: yeiQ    Texpresso search in the literature
Synonym(s): ECK2166, EG12036, b2172
Genome position(nucleotides): 2266245 --> 2267711 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.01
External database links:  
ASAP:
ABE-0007191
ECHOBASE:
EB1971
ECOLIHUB:
yeiQ
OU-MICROARRAY:
b2172
STRING:
511145.b2172
COLOMBOS: yeiQ


Product      
Name: putative oxidoreductase YeiQ
Synonym(s): YeiQ, putative dehydrogenase, NAD-dependent
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 54.032
Isoelectric point: 6.071
Motif(s):
 
Type Positions Sequence
26 -> 188 RIVHFGFGAFHRAHQALLTDRVLNAQGGDWGICEISLFSGDQLMSQLRAQNHLYTVLEKGADGNQVIIVGAVHECLNAKLDSLAAIIEKFCEPQVAIVSLTITEKGYCIDPATGALDTSNPRIIHDLQTPEEPHSAPGILVEALKRRRERGLTPFTVLSCDNI
48 -> 48 L
216 -> 462 EHVSFPGTMVDRIVPAATDESLVEISQHLGVNDPCAISCEPFIQWVVEDNFVAGRPAWEVAGVQMVNDVLPWEEMKLRMLNGSHSFLAYLGYLSGFAHISDCMQDRAFRHAARTLMLDEQAPTLQIKDVDLTQYADKLIARFANPALKHKTWQIAMDGSQKLPQRMLAGIRIHQGRETDWSLLALGVAGWMRYVSGVDDAGNAIDVRDPLSDKIRELVAGSSSEQRVTALLSLREVFGDDLPDNPHF
27 -> 38 IVHFGFGAFHRA

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016491 - oxidoreductase activity
GO:0016616 - oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
biological_process GO:0055114 - oxidation-reduction process
GO:0019594 - mannitol metabolic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG12036-MONOMER
ECOLIWIKI:
b2172
INTERPRO:
IPR023027
INTERPRO:
IPR013131
INTERPRO:
IPR036291
INTERPRO:
IPR013328
INTERPRO:
IPR000669
INTERPRO:
IPR008927
INTERPRO:
IPR013118
MODBASE:
P33029
PFAM:
PF08125
PFAM:
PF01232
PRIDE:
P33029
PRINTS:
PR00084
PROSITE:
PS00974
REFSEQ:
NP_416677
SMR:
P33029
UNIPROT:
P33029


Operon      
Name: yeiQ         
Operon arrangement:
Transcription unit        Promoter
yeiQ


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yeiQp5 2266164 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yeiQp6 2266214 forward Similarity to the consensus
Read more >
[ICWHO], [RS-EPT-CBR] [1], [2]
  promoter yeiRp3 2267742 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_2472 2267796 forward nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB