RegulonDB RegulonDB 10.9: Gene Form
   

yejF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yejF yejE yejG yejG5\'

Gene      
Name: yejF    Texpresso search in the literature
Synonym(s): ECK2174, EG12041, b2180
Genome position(nucleotides): 2276300 --> 2277889 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.38
External database links:  
ASAP:
ABE-0007212
ECHOBASE:
EB1975
ECOLIHUB:
yejF
OU-MICROARRAY:
b2180
STRING:
511145.b2180
COLOMBOS: yejF


Product      
Name: putative oligopeptide ABC transporter ATP binding subunit YejF
Synonym(s): YejF
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 58.726
Isoelectric point: 9.341
Motif(s):
 
Type Positions Sequence
156 -> 160 QLSGG
287 -> 526 IRKGILKRIVDHNVVVKNISFTLRAGETLGLVGESGSGKSTTGLALLRLINSQGSIIFDGQPLQNLNRRQLLPIRHRIQVVFQDPNSSLNPRLNVLQIIEEGLRVHQPTLSAAQREQQVIAVMHEVGLDPETRHRYPAEFSGGQRQRIAIARALILKPSLIILDEPTSSLDKTVQAQILTLLKSLQQKHQLAYLFISHDLHVVRALCHQVIILRQGEVVEQGPCARVFATPQQEYTRQLL
319 -> 326 GESGSGKS
6 -> 257 LAIENLSVGFRHQQTVRTVVNDVSLQIEAGETLALVGESGSGKSVTALSILRLLPSPPVEYLSGDIRFHGESLLHASDQTLRGVRGNKIAMIFQEPMVSLNPLHTLEKQLYEVLSLHRGMRREAARGEILNCLDRVGIRQAAKRLTDYPHQLSGGERQRVMIAMALLTRPELLIADEPTTALDVSVQAQILQLLRELQGELNMGMLFITHNLSIVRKLAHRVAVMQNGRCVEQNYAATLFASPTHPYTQKLL
177 -> 184 LLIADEPT

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.a - ABC superfamily ATP binding cytoplasmic component
Gene Ontology Terms (GO)  
cellular_component GO:0005886 - plasma membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
molecular_function GO:0005515 - protein binding
GO:0016887 - ATPase activity
GO:0042626 - ATPase-coupled transmembrane transporter activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0022857 - transmembrane transporter activity
GO:0035673 - oligopeptide transmembrane transporter activity
biological_process GO:0015833 - peptide transport
GO:0042884 - microcin transport
GO:0055085 - transmembrane transport
GO:0035672 - oligopeptide transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [1] Jindal S., et al., 2019
External database links:  
DIP:
DIP-11936N
ECOCYC:
YEJF-MONOMER
ECOLIWIKI:
b2180
INTERPRO:
IPR027417
INTERPRO:
IPR013563
INTERPRO:
IPR003593
INTERPRO:
IPR003439
INTERPRO:
IPR017871
MODBASE:
P33916
PFAM:
PF08352
PFAM:
PF00005
PRIDE:
P33916
PROSITE:
PS50893
PROSITE:
PS00211
REFSEQ:
NP_416685
SMART:
SM00382
UNIPROT:
P33916


Operon      
Name: yejABEF         
Operon arrangement:
Transcription unit        Promoter
yejABEF


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Jindal S., Yang L., Day PJ., Kell DB., 2019, Involvement of multiple influx and efflux transporters in the accumulation of cationic fluorescent dyes by Escherichia coli., BMC Microbiol 19(1):195


RegulonDB