RegulonDB RegulonDB 10.9: Gene Form
   

yejL gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yejM yejK yejL Fis terminator TSS_2482 (cluster) TSS_2482 (cluster) yejKp5 yejKp5 TSS_2481 TSS_2481 TSS_2480 TSS_2480

Gene      
Name: yejL    Texpresso search in the literature
Synonym(s): ECK2181, EG12043, b2187
Genome position(nucleotides): 2284129 --> 2284356 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.44
External database links:  
ASAP:
ABE-0007238
ECHOBASE:
EB1977
ECOLIHUB:
yejL
OU-MICROARRAY:
b2187
STRING:
511145.b2187
COLOMBOS: yejL


Product      
Name: DUF1414 domain-containing protein YejL
Synonym(s): YejL
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 8.288
Isoelectric point: 5.601
Motif(s):
 
Type Positions Sequence
26 -> 69 HKAPTDLSLMVLGNMVTNLINTSIAPAQRQAIANSFARALQSSI

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
Reference(s): [1] Paradis-Bleau C., et al., 2014
External database links:  
DIP:
DIP-48181N
ECOCYC:
EG12043-MONOMER
ECOLIWIKI:
b2187
INTERPRO:
IPR009857
INTERPRO:
IPR023202
PDB:
2JRX
PFAM:
PF07208
PRIDE:
P0AD24
REFSEQ:
NP_416692
SMR:
P0AD24
UNIPROT:
P0AD24


Operon      
Name: yejLM         
Operon arrangement:
Transcription unit        Promoter
yejLM


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2480 2283645 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2481 2283969 reverse nd [RS-EPT-CBR] [2]
  promoter yejKp5 2284109 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter TSS_2482 (cluster) 2285798 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Paradis-Bleau C., Kritikos G., Orlova K., Typas A., Bernhardt TG., 2014, A genome-wide screen for bacterial envelope biogenesis mutants identifies a novel factor involved in cell wall precursor metabolism., PLoS Genet 10(1):e1004056

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB