RegulonDB RegulonDB 10.9: Gene Form
   

rsuA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: rsuA    Texpresso search in the literature
Synonym(s): ECK2177, EG12044, b2183, yejD
Genome position(nucleotides): 2279788 <-- 2280483 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.87
External database links:  
ASAP:
ABE-0007223
CGSC:
36034
ECHOBASE:
EB1978
ECOLIHUB:
rsuA
OU-MICROARRAY:
b2183
STRING:
511145.b2183
COLOMBOS: rsuA


Product      
Name: 16S rRNA pseudouridine516 synthase
Synonym(s): RsuA, YejD
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 25.865
Isoelectric point: 6.122
Motif(s):
 
Type Positions Sequence
62 -> 192 YFMLNKPQGYVCSTDDPDHPTVLYFLDEPVAWKLHAAGRLDIDTTGLVLMTDDGQWSHRITSPRHHCEKTYLVTLESPVADDTAEQFAKGVQLHNEKDLTKPAVLEVITPTQVRLTISEGRYHQVKRMFAA
1 -> 45 MRLDKFIAQQLGVSRAIAGREIRGNRVTVDGEIVRNAAFKLLPEH
102 -> 102 D

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.3 - RNA modification
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0120159 - rRNA pseudouridine synthase activity
GO:0005515 - protein binding
GO:0016853 - isomerase activity
GO:0016866 - intramolecular transferase activity
GO:0003723 - RNA binding
GO:0009982 - pseudouridine synthase activity
biological_process GO:0009451 - RNA modification
GO:0001522 - pseudouridine synthesis
GO:0006364 - rRNA processing
GO:0000455 - enzyme-directed rRNA pseudouridine synthesis
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-35902N
ECOCYC:
EG12044-MONOMER
ECOLIWIKI:
b2183
INTERPRO:
IPR036986
INTERPRO:
IPR020103
INTERPRO:
IPR042092
INTERPRO:
IPR000748
INTERPRO:
IPR002942
INTERPRO:
IPR006145
INTERPRO:
IPR018496
MODBASE:
P0AA43
PDB:
1KSV
PDB:
1KSL
PDB:
1KSK
PFAM:
PF01479
PFAM:
PF00849
PRIDE:
P0AA43
PRODB:
PRO_000023891
PROSITE:
PS01149
PROSITE:
PS50889
REFSEQ:
NP_416688
SMART:
SM00363
SMR:
P0AA43
UNIPROT:
P0AA43


Operon      
Name: rsuA         
Operon arrangement:
Transcription unit        Promoter
rsuA


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2478 2279068 reverse nd [RS-EPT-CBR] [1]
  promoter rsuAp2 2280545 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter rsuAp3 2280548 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_2479 2280608 forward nd [RS-EPT-CBR] [1]



RegulonDB