RegulonDB RegulonDB 10.9: Gene Form
   

yejK gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yejK rplY yejL terminator yejKp5 yejKp5 TSS_2481 TSS_2481 TSS_2480 TSS_2480

Gene      
Name: yejK    Texpresso search in the literature
Synonym(s): ECK2180, EG12048, b2186, ndpA
Genome position(nucleotides): 2282940 <-- 2283947 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.28
External database links:  
ASAP:
ABE-0007234
ECHOBASE:
EB1980
ECOLIHUB:
yejK
OU-MICROARRAY:
b2186
STRING:
511145.b2186
COLOMBOS: yejK


Product      
Name: nucleoid-associated protein YejK
Synonym(s): NdpA, YejK
Sequence: Get amino acid sequence Fasta Format
Cellular location: bacterial nucleoid,cytosol
Molecular weight: 37.822
Isoelectric point: 4.596
Motif(s):
 
Type Positions Sequence
10 -> 324 LHQLIKRDEQNLELVLRDSLLEPTETVVEMVAELHRVYSAKNKAYGLFSEESELAQTLRLQRQGEEDFLAFSRAATGRLRDELAKYPFADGGFVLFCHYRYLAVEYLLVAVLSNLSSMRVNENLDINPTHYLDINHADIVARIDLTEWETNPESTRYLTFLKGRVGRKVADFFMDFLGASEGLNAKAQNRGLLQAVDDFTAEAQLDKAERQNVRQQVYSYCNEQLQAGEEIELKSLSKELAGVSEVSFTEFAAEKGYELEESFPADRSTLRQLTKFAGSGGGLTINFDAMLLGERIFWDPATDTLTIKGTPPNLR
2 -> 335 SLDINQIALHQLIKRDEQNLELVLRDSLLEPTETVVEMVAELHRVYSAKNKAYGLFSEESELAQTLRLQRQGEEDFLAFSRAATGRLRDELAKYPFADGGFVLFCHYRYLAVEYLLVAVLSNLSSMRVNENLDINPTHYLDINHADIVARIDLTEWETNPESTRYLTFLKGRVGRKVADFFMDFLGASEGLNAKAQNRGLLQAVDDFTAEAQLDKAERQNVRQQVYSYCNEQLQAGEEIELKSLSKELAGVSEVSFTEFAAEKGYELEESFPADRSTLRQLTKFAGSGGGLTINFDAMLLGERIFWDPATDTLTIKGTPPNLRDQLQRRTSGGN

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.7 - nucleoproteins, basic proteins
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0009295 - nucleoid
GO:0043590 - bacterial nucleoid
molecular_function GO:0005515 - protein binding
GO:0003727 - single-stranded RNA binding
GO:0003690 - double-stranded DNA binding
GO:0042802 - identical protein binding
Note(s): Note(s): ...[more].
Reference(s): [1] Takeda T., et al., 2011
External database links:  
DIP:
DIP-11939N
ECOCYC:
EG12048-MONOMER
ECOLIWIKI:
b2186
INTERPRO:
IPR007358
PANTHER:
PTHR38772
PFAM:
PF04245
PRIDE:
P33920
PRODB:
PRO_000023367
REFSEQ:
NP_416691
UNIPROT:
P33920


Operon      
Name: yejK         
Operon arrangement:
Transcription unit        Promoter
yejK


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2480 2283645 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2481 2283969 reverse nd [RS-EPT-CBR] [2]
  promoter yejKp5 2284109 reverse Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Takeda T., Yun CS., Shintani M., Yamane H., Nojiri H., 2011, Distribution of genes encoding nucleoid-associated protein homologs in plasmids., Int J Evol Biol 685015

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB