RegulonDB RegulonDB 10.10: Gene Form
   

lapC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yejM yejL proL Fis proLp proLp TSS_2482 (cluster) TSS_2482 (cluster)

Gene      
Name: lapC    Texpresso search in the literature
Synonym(s): ECK2182, EG12049, b2188, pbgA, yejM, yejN
Genome position(nucleotides): 2284376 --> 2286136 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.07
External database links:  
ASAP:
ABE-0007240
ECHOBASE:
EB1981
ECOLIHUB:
yejM
OU-MICROARRAY:
b2188
STRING:
511145.b2188
COLOMBOS: lapC


Product      
Name: lipopolysaccharide signal transducer LapC
Synonym(s): LapC, PbgA, YejM, YejN, lipopolysaccharide assembly protein C
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space,inner membrane
Molecular weight: 67.296
Isoelectric point: 9.399
Motif(s):
 
Type Positions Sequence
347 -> 370 DGFTSPLYRQALLSDFSMPSVRTQ
349 -> 349 F
135 -> 157 WQLMFISVPVILLLELVFATWSW
169 -> 191 FARPLAAFLFIAFIASHVVYIWA
6 -> 252 QRYREKVSQMVSWGHWFALFNILLSLVIGSRYLFIADWPTTLAGRIYSYVSIIGHFSFLVFATYLLILFPLTFIVGSQRLMRFLSVILATAGMTLLLIDSEVFTRFHLHLNPIVWQLVINPDENEMARDWQLMFISVPVILLLELVFATWSWQKLRSLTRRRRFARPLAAFLFIAFIASHVVYIWADANFYRPITMQRANLPLSYPMTARRFLEKHGLLDAQEYQRRLIEQGNPDAVSVQYPLSELR

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0030288 - outer membrane-bounded periplasmic space
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0003824 - catalytic activity
GO:0005515 - protein binding
GO:0008484 - sulfuric ester hydrolase activity
biological_process GO:0055088 - lipid homeostasis
Note(s): Note(s): ...[more].
Evidence: [IGI] Inferred from genetic interaction
Reference(s): [1] Bishop RE. 2020
[2] Fivenson EM., et al., 2020
[3] Guest RL., et al., 2020
[4] O'Reilly EK., et al., 2004
External database links:  
ECOCYC:
EG12049-MONOMER
ECOLIWIKI:
b2188
INTERPRO:
IPR017850
INTERPRO:
IPR024588
INTERPRO:
IPR012159
INTERPRO:
IPR000917
MODBASE:
P0AD27
PDB:
5I5H
PFAM:
PF00884
PFAM:
PF11893
PRIDE:
P0AD27
REFSEQ:
NP_416693
SMR:
P0AD27
UNIPROT:
P0AD27


Operon      
Name: yejL-lapC         
Operon arrangement:
Transcription unit        Promoter
yejLM


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2482 (cluster) 2285798 forward nd [RS-EPT-CBR] [5]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Bishop RE., 2020, Structure of a lipopolysaccharide regulator reveals a road to new antibiotics., Nature 584(7821):348-349

 [2] Fivenson EM., Bernhardt TG., 2020, An Essential Membrane Protein Modulates the Proteolysis of LpxC to Control Lipopolysaccharide Synthesis in Escherichia coli., mBio 11(3)

 [3] Guest RL., Same Guerra D., Wissler M., Grimm J., Silhavy TJ., 2020, YejM Modulates Activity of the YciM/FtsH Protease Complex To Prevent Lethal Accumulation of Lipopolysaccharide., mBio 11(2)

 [4] O'Reilly EK., Kreuzer KN., 2004, Isolation of SOS constitutive mutants of Escherichia coli., J Bacteriol 186(21):7149-60

 [5] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB