RegulonDB RegulonDB 10.10: Gene Form
   

yejO gene in Escherichia coli K-12 genome

Gene      
Name: yejO    Texpresso search in the literature
Synonym(s): ECK2184, EG12051, b2190
Type: Pseudo Gene
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.72
External database links:  
ASAP:
ABE-0007244
ECHOBASE:
EB1982
ECOLIHUB:
yejO
OU-MICROARRAY:
b2190
STRING:
316407.85675298
COLOMBOS: yejO


Product      
Name: adhesin-like autotransporter YejO
Sequence: Get amino acid sequence Fasta Format
Isoelectric point: 11.681
Motif(s):
 
Type Positions Sequence
30 -> 863 *YEIMFVIWSHRTGFIMSHQLTFADSEFSSKRRQTRKEIFLSRMEQILPWQNMVEVIEPFYPKAGNGRRPYPLETMLRIHCMQHWYNLSDGAMEDALYEIASMRLFARLSLDSALPDRTTIMNFRHLLEQHQLARQLFKTINRWLAEAGVMMTQGTLVDATIIEAPSSTKNKEQQRDPEMHQTKKGNQWHFGMKAHIGVDAKSGLTHSLVTTAANEHDLNQLGNLLHGEEQFVSADAGYQGAPQREELAEVDVDWLIAERPGKVRTLKQHPRKNKTAINIEYMKASIRARVEHPFRIIKRQFGFVKARYKGLLKNDNQLAMLFTLANLFRADQMIRQWERSH*KLGITP*MAKKRSK*ADSRHLREKKSAQT*RNEMTESAEKNFPAYSHLPYIHP*HWHQLLSMVRQLMVLSWKKISSWFMGPPIIRKSILAENSI*KNLV*VIILKLTEGISTLK*MAPQNTQY*MTVIKLFKWVARQTRLRSIMVCYRFMAQRMIPRLKAGA*SLKKMGGPSLSLSKREDYWRLKRGDLHLR*IRKQAVLLKQPRGPWRYSEQTVSVSSISRMVLLIICCWKTAEVCELKKMTSLIIPL*IVAAYWRLWMAGL*LALIKKQAEN*LSQRMRWK*VVQTVKANLV*KMVCQKIMNWMMVPGSLLWRTRRPLILSLISMPLCNRWERILVRKCRQMRYMISVDHIRMEVSRIPQKPSLKIWLSTMAALTSGLAQWLTFQSEGMMAFLRS*SRK*IMHPQCWWVR*WFLRALLLERMVPWIPAKRTFRSKIAYGPSLPISLRRTKTPSST*PTLRCLTQM*L*WMSQ*LVHQ*RQVRKISLR*P
595 -> 863 MVLLIICCWKTAEVCELKKMTSLIIPL*IVAAYWRLWMAGL*LALIKKQAEN*LSQRMRWK*VVQTVKANLV*KMVCQKIMNWMMVPGSLLWRTRRPLILSLISMPLCNRWERILVRKCRQMRYMISVDHIRMEVSRIPQKPSLKIWLSTMAALTSGLAQWLTFQSEGMMAFLRS*SRK*IMHPQCWWVR*WFLRALLLERMVPWIPAKRTFRSKIAYGPSLPISLRRTKTPSST*PTLRCLTQM*L*WMSQ*LVHQ*RQVRKISLR*P
1 -> 29 MHQSGSVSLCRSAISVLVATALWKVRTSP

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005576 - extracellular region
Note(s): Note(s): ...[more].
Reference(s): [1] Roux A., et al., 2005
[2] Wells TJ., et al., 2010
External database links:  
DIP:
DIP-11942N
ECOCYC:
EG12051-MONOMER
ECOLIWIKI:
b2190
INTERPRO:
IPR036709
INTERPRO:
IPR003991
INTERPRO:
IPR012332
INTERPRO:
IPR030930
INTERPRO:
IPR004899
INTERPRO:
IPR005546
INTERPRO:
IPR006315
INTERPRO:
IPR011050
MINT:
MINT-1322746
MODBASE:
P33924
PFAM:
PF03212
PFAM:
PF16168
PFAM:
PF03797
PRIDE:
P33924
PRINTS:
PR01484
PROSITE:
PS51208
REFSEQ:
NP_416694
SMART:
SM00869
SMR:
P33924
SWISSMODEL:
P33924
UNIPROT:
P33924


Operon      
Name: yejO         
Operon arrangement:
Transcription unit        Promoter
yejO


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Roux A., Beloin C., Ghigo JM., 2005, Combined inactivation and expression strategy to study gene function under physiological conditions: application to identification of new Escherichia coli adhesins., J Bacteriol 187(3):1001-13

 [2] Wells TJ., Totsika M., Schembri MA., 2010, Autotransporters of Escherichia coli: a sequence-based characterization., Microbiology 156(Pt 8):2459-69


RegulonDB