RegulonDB RegulonDB 10.9: Gene Form
   

ccmB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: ccmB    Texpresso search in the literature
Synonym(s): ECK2192, EG12058, b2200, yejV
Genome position(nucleotides): 2296362 <-- 2297024 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.96
External database links:  
ASAP:
ABE-0007277
CGSC:
36577
ECHOBASE:
EB1988
ECOLIHUB:
ccmB
OU-MICROARRAY:
b2200
STRING:
511145.b2200
COLOMBOS: ccmB


Product      
Name: cytochrome c maturation protein B
Synonym(s): CcmB, YejV, heme trafficking system protein B
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 23.619
Isoelectric point: 7.79
Motif(s):
 
Type Positions Sequence
3 -> 217 FWRIFRLELRVAFRHSAEIANPLWFFLIVITLFPLSIGPEPQLLARIAPGIIWVAALLSSLLALERLFRDDLQDGSLEQLMLLPLPLPAVVLAKVMAHWMVTGLPLLILSPLVAMLLGMDVYGWQVMALTLLLGTPTLGFLGAPGVALTVGLKRGGVLLSILVLPLTIPLLIFATAAMDAASMHLPVDGYLAILGALLAGTATLSPFATAAALRI
193 -> 213 LAILGALLAGTATLSPFATAA
21 -> 41 IANPLWFFLIVITLFPLSIGP
45 -> 65 LLARIAPGIIWVAALLSSLLA
101 -> 121 WMVTGLPLLILSPLVAMLLGM

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.15 - large molecule carriers --> 1.6.15.1 - cytochromes
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
molecular_function GO:0005515 - protein binding
GO:0015232 - heme transmembrane transporter activity
biological_process GO:1903607 - cytochrome c biosynthetic process
GO:0017004 - cytochrome complex assembly
GO:0015886 - heme transport
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-48046N
ECOCYC:
CCMB-MONOMER
ECOLIWIKI:
b2200
INTERPRO:
IPR026031
INTERPRO:
IPR003544
PANTHER:
PTHR30070
PFAM:
PF03379
PRIDE:
P0ABL8
PRODB:
PRO_000022258
REFSEQ:
NP_416704
UNIPROT:
P0ABL8


Operon      
Name: napFDAGHBC-ccmABCDEFGH         
Operon arrangement:
Transcription unit        Promoter
napFDAGHBC-ccmABCDEFGH
napFDAGHBC-ccmABCDEFGH
napFDAGHBC
ccmABCDEFGH


Transcriptional Regulation      
Display Regulation             
Activated by: FNR, ModE, FlhDC, NarP
Repressed by: NarL, NarP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB