RegulonDB RegulonDB 10.9: Gene Form
   

napC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ccmA napC napB ccmB napH

Gene      
Name: napC    Texpresso search in the literature
Synonym(s): ECK2194, EG12060, b2202, yejX
Genome position(nucleotides): 2297657 <-- 2298259 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.58
External database links:  
ASAP:
ABE-0007281
CGSC:
36566
ECHOBASE:
EB1990
ECOLIHUB:
napC
OU-MICROARRAY:
b2202
STRING:
511145.b2202
COLOMBOS: napC


Product      
Name: periplasmic nitrate reductase cytochrome c protein
Synonym(s): NapC, YejX, cytochrome c-type protein
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 23.101
Isoelectric point: 8.741
Motif(s):
 
Type Positions Sequence
22 -> 193 SRLALGTLLLIGFVGGIVFWGGFNTGMEKANTEEFCISCHEMRNTVYQEYMDSVHYNNRSGVRATCPDCHVPHEFVPKMIRKLKASKELYGKIFGVIDTPQKFEAHRLTMAQNEWRRMKDNNSQECRNCHNFEYMDTTAQKSVAAKMHDQAVKDGQTCIDCHKGIAHKLPDM
24 -> 44 LALGTLLLIGFVGGIVFWGGF

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.7 - anaerobic respiration
  1 - metabolism --> 1.4 - energy production/transport --> 1.4.2 - electron acceptors
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.15 - large molecule carriers --> 1.6.15.1 - cytochromes
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0009055 - electron transfer activity
GO:0046872 - metal ion binding
GO:0020037 - heme binding
biological_process GO:0009061 - anaerobic respiration
GO:0022900 - electron transport chain
GO:0055114 - oxidation-reduction process
GO:0019333 - denitrification pathway
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-10306N
ECOCYC:
NAPC-MONOMER
ECOLIWIKI:
b2202
INTERPRO:
IPR011031
INTERPRO:
IPR038266
INTERPRO:
IPR036280
INTERPRO:
IPR024717
INTERPRO:
IPR011885
INTERPRO:
IPR005126
MODBASE:
P0ABL5
PFAM:
PF03264
PRIDE:
P0ABL5
PRODB:
PRO_000023347
PROSITE:
PS51008
REFSEQ:
NP_416706
UNIPROT:
P0ABL5


Operon      
Name: napFDAGHBC-ccmABCDEFGH         
Operon arrangement:
Transcription unit        Promoter
napFDAGHBC-ccmABCDEFGH
napFDAGHBC-ccmABCDEFGH
napFDAGHBC
ccmABCDEFGH


Transcriptional Regulation      
Display Regulation             
Activated by: FNR, ModE, FlhDC, NarP
Repressed by: IscR, NarL, NarP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB