RegulonDB RegulonDB 10.9: Gene Form
   

napH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

napA napH napG napC napB napD

Gene      
Name: napH    Texpresso search in the literature
Synonym(s): ECK2196, EG12062, b2204, yejZ
Genome position(nucleotides): 2298715 <-- 2299578 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.9
External database links:  
ASAP:
ABE-0007285
CGSC:
36556
ECHOBASE:
EB1992
ECOLIHUB:
napH
OU-MICROARRAY:
b2204
STRING:
511145.b2204
COLOMBOS: napH


Product      
Name: ferredoxin-type protein NapH
Synonym(s): NapH, YejZ
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 31.873
Isoelectric point: 8.624
Motif(s):
 
Type Positions Sequence
80 -> 100 LPATVALTGAVIITVLYALAG
179 -> 211 LLILALFLFDLLVVEHGWCGHICPVGALYGVLG
83 -> 126 TVALTGAVIITVLYALAGKRLFCSWVCPLNPITDLANWLRRRFD
217 -> 247 TVAATDRQKCNRCMDCFHVCPEPHVLRAPVL
140 -> 160 VLLVVILVGSALTGTLIWEWI

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.7 - anaerobic respiration
  1 - metabolism --> 1.4 - energy production/transport --> 1.4.3 - electron carriers
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0046872 - metal ion binding
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
biological_process GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-10310N
ECOCYC:
NAPH-MONOMER
ECOLIWIKI:
b2204
INTERPRO:
IPR017896
INTERPRO:
IPR011886
INTERPRO:
IPR017900
MODBASE:
P33934
PFAM:
PF12801
PFAM:
PF13237
PRIDE:
P33934
PRODB:
PRO_000023350
PROSITE:
PS51379
PROSITE:
PS00198
REFSEQ:
NP_416708
UNIPROT:
P33934


Operon      
Name: napFDAGHBC-ccmABCDEFGH         
Operon arrangement:
Transcription unit        Promoter
napFDAGHBC-ccmABCDEFGH
napFDAGHBC-ccmABCDEFGH
napFDAGHBC
ccmABCDEFGH


Transcriptional Regulation      
Display Regulation             
Activated by: FNR, NarP, FlhDC, ModE
Repressed by: IscR, NarL, NarP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB