RegulonDB RegulonDB 10.9: Gene Form
   

secG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

glmM secG leuU folP anti-anti-terminator anti-terminator terminator TSS_3476 TSS_3476 secGp2 secGp2 secGp1 secGp1 leuUp leuUp

Gene      
Name: secG    Texpresso search in the literature
Synonym(s): ECK3164, EG12095, b3175, prlH
Genome position(nucleotides): 3322173 <-- 3322505 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.55
External database links:  
ASAP:
ABE-0010436
CGSC:
33484
ECHOBASE:
EB2019
ECOLIHUB:
secG
OU-MICROARRAY:
b3175
STRING:
511145.b3175
COLOMBOS: secG


Product      
Name: Sec translocon subunit SecG
Synonym(s): PrlH, SecG, p12
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 11.365
Isoelectric point: 6.707
Motif(s):
 
Type Positions Sequence
4 -> 22 ALLVVFLIVAIGLVGLIML
26 -> 26 K
5 -> 72 LLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLATLFFIISLVLGN
16 -> 16 L
48 -> 48 S

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.5 - The Type II (General) Secretory Pathway (IISP) Family
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
GO:0031522 - cell envelope Sec protein transport complex
molecular_function GO:0005515 - protein binding
GO:0008320 - protein transmembrane transporter activity
GO:0015450 - P-P-bond-hydrolysis-driven protein transmembrane transporter activity
biological_process GO:0015031 - protein transport
GO:0006886 - intracellular protein transport
GO:0009306 - protein secretion
GO:0065002 - intracellular protein transmembrane transport
GO:0032978 - protein insertion into membrane from inner side
GO:0043952 - protein transport by the Sec complex
GO:0006616 - SRP-dependent cotranslational protein targeting to membrane, translocation
Note(s): Note(s): ...[more].
Reference(s): [1] Hanada M., et al., 1996
[2] Mori H., et al., 1998
[3] Ramamurthy V., et al., 1998
[4] Suzuki H., et al., 1999
External database links:  
DIP:
DIP-47480N
ECOCYC:
SECG
ECOLIWIKI:
b3175
INTERPRO:
IPR004692
MINT:
P0AG99
PANTHER:
PTHR34182
PDB:
5NCO
PDB:
3J46
PDB:
3J45
PDB:
2AKI
PDB:
2AKH
PDB:
5MG3
PFAM:
PF03840
PRIDE:
P0AG99
PRINTS:
PR01651
PRODB:
PRO_000023928
REFSEQ:
NP_417642
SMR:
P0AG99
UNIPROT:
P0AG99


Operon      
Name: secG-leuU         
Operon arrangement:
Transcription unit        Promoter
leuU
secG-leuU
secG-leuU
secG


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3476 3323735 reverse nd [RS-EPT-CBR] [5]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Hanada M., Nishiyama K., Tokuda H., 1996, SecG plays a critical role in protein translocation in the absence of the proton motive force as well as at low temperature., FEBS Lett 381(1-2):25-8

 [2] Mori H., Sugiyama H., Yamanaka M., Sato K., Tagaya M., Mizushima S., 1998, Amino-terminal region of SecA is involved in the function of SecG for protein translocation into Escherichia coli membrane vesicles., J Biochem 124(1):122-9

 [3] Ramamurthy V., Dapic V., Oliver D., 1998, secG and temperature modulate expression of azide-resistant and signal sequence suppressor phenotypes of Escherichia coli secA mutants., J Bacteriol 180(23):6419-23

 [4] Suzuki H., Nishiyama K., Tokuda H., 1999, Increases in acidic phospholipid contents specifically restore protein translocation in a cold-sensitive secA or secG null mutant., J Biol Chem 274(43):31020-4

 [5] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB