RegulonDB RegulonDB 10.8: Gene Form
   

feoA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yhgF feoB feoA Fur FNR NagC TSS_4010 TSS_4010 TSS_4009 TSS_4009 TSS_4008 (cluster) TSS_4008 (cluster) TSS_4007 TSS_4007 TSS_4006 TSS_4006 feoAp feoAp

Gene      
Name: feoA    Texpresso search in the literature
Synonym(s): ECK3395, EG12101, b3408
Genome position(nucleotides): 3540163 --> 3540390 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.68
External database links:  
ASAP:
ABE-0011124
CGSC:
28964
ECHOBASE:
EB2025
OU-MICROARRAY:
b3408
PortEco:
feoA
STRING:
511145.b3408
COLOMBOS: feoA


Product      
Name: ferrous iron transport protein A
Synonym(s): FeoA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 8.371
Isoelectric point: 9.838
Motif(s):
 
Type Positions Sequence
5 -> 71 PDTAWKITGFSREISPAYRQKLLSLGMLPGSSFNVVRVAPLGDPIHIETRRVSLVLRKKDLALLEVE

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.9.A - Transporters of Unknown Classification
  5 - cell processes --> 5.5 - adaptations --> 5.5.7 - Fe aquisition
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
molecular_function GO:0046914 - transition metal ion binding
biological_process GO:0006811 - ion transport
GO:0006974 - cellular response to DNA damage stimulus
GO:0055072 - iron ion homeostasis
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Kammler M., et al., 1993
External database links:  
ECOCYC:
EG12101-MONOMER
ECOLIWIKI:
b3408
INTERPRO:
IPR007167
INTERPRO:
IPR038157
INTERPRO:
IPR008988
PDB:
2LX9
PFAM:
PF04023
PRIDE:
P0AEL3
PRODB:
PRO_000022597
REFSEQ:
NP_417867
SMART:
SM00899
SMR:
P0AEL3
UNIPROT:
P0AEL3


Operon      
Name: feoABC         
Operon arrangement:
Transcription unit        Promoter
feoABC


Transcriptional Regulation      
Display Regulation             
Activated by: FNR
Repressed by: Fur
Undetermined regulation NagC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4006 3540058 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4007 3540444 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4008 (cluster) 3540462 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_4009 3540588 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4010 3542195 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Kammler M., Schon C., Hantke K., 1993, Characterization of the ferrous iron uptake system of Escherichia coli., J Bacteriol 175(19):6212-9

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB