RegulonDB RegulonDB 10.8: Gene Form
   

feoB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

feoB rpnA feoC feoA terminator anti-terminator yhgAp6 yhgAp6 TSS_4010 TSS_4010 TSS_4009 TSS_4009 TSS_4008 (cluster) TSS_4008 (cluster) TSS_4007 TSS_4007

Gene      
Name: feoB    Texpresso search in the literature
Synonym(s): ECK3396, EG12102, b3409
Genome position(nucleotides): 3540407 --> 3542728 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.74
External database links:  
ASAP:
ABE-0011126
CGSC:
28967
ECHOBASE:
EB2026
OU-MICROARRAY:
b3409
PortEco:
feoB
STRING:
511145.b3409
COLOMBOS: feoB


Product      
Name: Fe2+ transporter FeoB
Synonym(s): FeoB, ferrous iron transport protein B, ferrous iron transporter
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 84.474
Isoelectric point: 6.109
Motif(s):
 
Type Positions Sequence
61 -> 61 Y
120 -> 123 NMLD
150 -> 150 S
178 -> 280 AQPLLNEADSLAKVMPSDIPLKQRRWLGLQMLEGDIYSRAYAGEASQHLDAALARLRNEMDDPALHIADARYQCIAAICDVVSNTLTAEPSRFTTAVDKIVLN
25 -> 40 GSRQRVGNWAGVTVER

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.9.A - Transporters of Unknown Classification
  5 - cell processes --> 5.5 - adaptations --> 5.5.7 - Fe aquisition
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0005623 - cell
GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0015093 - ferrous iron transmembrane transporter activity
GO:0000166 - nucleotide binding
GO:0005525 - GTP binding
GO:0042802 - identical protein binding
biological_process GO:0098711 - iron ion import across plasma membrane
GO:0006811 - ion transport
GO:0006826 - iron ion transport
GO:0006974 - cellular response to DNA damage stimulus
GO:0055072 - iron ion homeostasis
GO:0072511 - divalent inorganic cation transport
Note(s): Note(s): ...[more].
Reference(s): [1] Hagelueken G., et al., 2015
[2] Hagelueken G., et al., 2016
External database links:  
DIP:
DIP-9591N
ECOCYC:
FEOB-MONOMER
ECOLIWIKI:
b3409
INTERPRO:
IPR030389
INTERPRO:
IPR027417
INTERPRO:
IPR003373
INTERPRO:
IPR011642
INTERPRO:
IPR041069
INTERPRO:
IPR011640
MINT:
P33650
MODBASE:
P33650
PANTHER:
PTHR11649:SF37
PDB:
4Q5I
PDB:
4Q00
PDB:
4R98
PDB:
3HYR
PDB:
3HYT
PDB:
3I8S
PDB:
3I8X
PDB:
3I92
PFAM:
PF07664
PFAM:
PF07670
PFAM:
PF17910
PFAM:
PF02421
PRIDE:
P33650
PRODB:
PRO_000022598
PROSITE:
PS51711
REFSEQ:
NP_417868
SMR:
P33650
UNIPROT:
P33650


Operon      
Name: feoABC         
Operon arrangement:
Transcription unit        Promoter
feoABC


Transcriptional Regulation      
Display Regulation             
Activated by: FNR
Repressed by: Fur
Undetermined regulation NagC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4007 3540444 forward nd [RS-EPT-CBR] [3]
  promoter TSS_4008 (cluster) 3540462 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_4009 3540588 forward nd [RS-EPT-CBR] [3]
  promoter TSS_4010 3542195 forward nd [RS-EPT-CBR] [3]
  promoter yhgAp6 3543147 forward Similarity to the consensus
Read more >
[ICWHO] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Hagelueken G., Duthie FG., Florin N., Schubert E., Schiemann O., 2015, Expression, purification and spin labelling of the ferrous iron transporter FeoB from Escherichia coli BL21 for EPR studies., Protein Expr Purif 114:30-6

 [2] Hagelueken G., Hoffmann J., Schubert E., Duthie FG., Florin N., Konrad L., Imhof D., Behrmann E., Morgner N., Schiemann O., 2016, Studies on the X-Ray and Solution Structure of FeoB from Escherichia coli BL21., Biophys J 110(12):2642-2650

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB