RegulonDB RegulonDB 10.9: Gene Form
   

yeiR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yeiQ yeiR lpxT lpxTp lpxTp TSS_2472 TSS_2472 yeiRp3 yeiRp3

Gene      
Name: yeiR    Texpresso search in the literature
Synonym(s): ECK2167, EG12104, b2173
Genome position(nucleotides): 2267829 --> 2268815 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.51
External database links:  
ASAP:
ABE-0007194
ECHOBASE:
EB2028
ECOLIHUB:
yeiR
OU-MICROARRAY:
b2173
STRING:
511145.b2173
COLOMBOS: yeiR


Product      
Name: zinc-binding GTPase YeiR
Synonym(s): YeiR
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 36.113
Isoelectric point: 6.44
Motif(s):
 
Type Positions Sequence
9 -> 17 GFLGSGKTT
5 -> 170 NLITGFLGSGKTTSILHLLAHKDPNEKWAVLVNEFGEVGIDGALLADSGALLKEIPGGCMCCVNGLPMQVGLNTLLRQGKPDRLLIEPTGLGHPKQILDLLTAPVYEPWIDLRATLCILDPRLLLDEKSASNENFRDQLAAADIIVANKSDRTTPESEQALQRWWQ
103 -> 105 DLL
241 -> 321 CGWIFDADTVFDTIGILEWARLAPVERVKGVLRIPEGLVRINRQGDDLHIETQNVAPPDSRIELISSSEADWNALQSALLK
242 -> 321 GWIFDADTVFDTIGILEWARLAPVERVKGVLRIPEGLVRINRQGDDLHIETQNVAPPDSRIELISSSEADWNALQSALLK

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0000166 - nucleotide binding
GO:0003924 - GTPase activity
GO:0005525 - GTP binding
GO:0008270 - zinc ion binding
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Blaby-Haas CE., et al., 2012
External database links:  
DIP:
DIP-11929N
ECOCYC:
EG12104-MONOMER
ECOLIWIKI:
b2173
INTERPRO:
IPR003495
INTERPRO:
IPR011629
INTERPRO:
IPR027417
MODBASE:
P33030
PFAM:
PF02492
PFAM:
PF07683
PRIDE:
P33030
REFSEQ:
NP_416678
SMART:
SM00833
SWISSMODEL:
P33030
UNIPROT:
P33030


Operon      
Name: yeiR-lpxT         
Operon arrangement:
Transcription unit        Promoter
lpxT
yeiR-lpxT


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yeiRp3 2267742 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_2472 2267796 forward nd [RS-EPT-CBR] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Blaby-Haas CE., Flood JA., Crecy-Lagard Vd., Zamble DB., 2012, YeiR: a metal-binding GTPase from Escherichia coli involved in metal homeostasis., Metallomics 4(5):488-97

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB