RegulonDB RegulonDB 10.9: Gene Form
   

ompX gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

opgE ompX yliM MicA CyaR ompXp2 ompXp2

Gene      
Name: ompX    Texpresso search in the literature
Synonym(s): ECK0803, EG12117, b0814, ompP, ybiG
Genome position(nucleotides): 850450 --> 850965 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.36
External database links:  
ASAP:
ABE-0002784
ECHOBASE:
EB2056
ECOLIHUB:
ompX
OU-MICROARRAY:
b0814
STRING:
511145.b0814
COLOMBOS: ompX


Product      
Name: outer membrane protein X
Synonym(s): OmpP, OmpX, YbiG
Sequence: Get amino acid sequence Fasta Format
Cellular location: outer membrane
Molecular weight: 18.603
Isoelectric point: 7.322
Motif(s):
 
Type Positions Sequence
1 -> 23 MKKIACLSALAAVLAFTAGTSVA
60 -> 69 LGVIGSFTYT
24 -> 171 ATSTVTGGYAQSDAQGQMNKMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTASSGDYNKNQYYGITAGPAYRINDWASIYGVVGVGYGKFQTTEYPTYKHDTSDYGFSYGAGLQFNPMENVALDFSYEQSRIRSVDVGTWIAGVGYRF
161 -> 170 GTWIAGVGYR
9 -> 171 ALAAVLAFTAGTSVAATSTVTGGYAQSDAQGQMNKMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTASSGDYNKNQYYGITAGPAYRINDWASIYGVVGVGYGKFQTTEYPTYKHDTSDYGFSYGAGLQFNPMENVALDFSYEQSRIRSVDVGTWIAGVGYRF

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0044384 - host outer membrane
GO:0009279 - cell outer membrane
GO:0016020 - membrane
GO:0016021 - integral component of membrane
molecular_function GO:0005515 - protein binding
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-48016N
ECOCYC:
EG12117-MONOMER
ECOLIWIKI:
b0814
INTERPRO:
IPR011250
INTERPRO:
IPR000758
INTERPRO:
IPR027385
MINT:
P0A917
MODBASE:
P0A917
PDB:
2MNH
PDB:
2M07
PDB:
2M06
PDB:
1QJ9
PDB:
1QJ8
PDB:
1Q9G
PDB:
1Q9F
PDB:
1ORM
PFAM:
PF13505
PRIDE:
P0A917
PRINTS:
PR00316
PRODB:
PRO_000023460
PROSITE:
PS00694
PROSITE:
PS00695
REFSEQ:
NP_415335
SMR:
P0A917
UNIPROT:
P0A917


Operon      
Name: yliM-ompX         
Operon arrangement:
Transcription unit        Promoter
yliM-ompX
ompX


Transcriptional Regulation      
Display Regulation             
Repressed by: FNR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB