RegulonDB RegulonDB 11.0: Gene Form
   

ychJ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rssA purU ychJ Fis ychJp ychJp TSS_1560 TSS_1560 rssAp rssAp purUp4 purUp4 purUp purUp purUp5 purUp5 purUp3 purUp3 TSS_1557 TSS_1557 TSS_1556 TSS_1556

Gene      
Name: ychJ    Texpresso search in the literature
Synonym(s): ECK1228, EG12119, b1233
Genome position(nucleotides): 1288674 <-- 1289132
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
46.41
External database links:  
ASAP:
ABE-0004140
ECHOBASE:
EB2040
ECOLIHUB:
ychJ
OU-MICROARRAY:
b1233
STRING:
511145.b1233
COLOMBOS: ychJ


Product      
Name: NTF2-like domain-containing protein YchJ
Synonym(s): YchJ
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 16.99
Isoelectric point: 7.293
Motif(s):
 
Type Positions Sequence Comment
1 -> 19 MSQLCPCGSAVEYSLCCHP
29 -> 127 DPEHLMRSRYCAFVMQDADYLIKTWHPSCGAAALRAELMAGFAHTEWLGLTVFEHCWQDADNIGFVSFVARFTEGGKTGAIIERSRFLKENGQWYYIDG
34 -> 35 MR UniProt: In Ref. 1; AAC36845..
59 -> 61 AAA UniProt: In Ref. 1; AAC36845..
134 -> 151 RNDPCPCGSGKKFKKCCG

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
Note(s): Note(s): ...[more].
External database links:  
ALPHAFOLD:
P37052
DIP:
DIP-11572N
ECOCYC:
EG12119-MONOMER
ECOLIWIKI:
b1233
INTERPRO:
IPR023006
INTERPRO:
IPR004027
INTERPRO:
IPR032710
PFAM:
PF17775
PFAM:
PF02810
PRIDE:
P37052
REFSEQ:
NP_415749
SMR:
P37052
UNIPROT:
P37052


Operon      
Name: ychJ-purU         
Operon arrangement:
Transcription unit        Promoter
purU
ychJ-purU
ychJ


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1556 1288063 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1557 1288077 reverse nd [RS-EPT-CBR] [1]
  promoter purUp3 1288751 reverse nd [ICWHO], [RS-EPT-CBR] [1], [2]
  promoter purUp5 1288753 reverse nd [ICWHO] [2]
  promoter purUp4 1288756 reverse nd [ICWHO] [2]
  promoter TSS_1560 1289150 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB