RegulonDB RegulonDB 10.9: Gene Form
   

rssA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rssB rssA ychJ rssBp rssBp ychJp ychJp TSS_1560 TSS_1560 rssAp rssAp purUp4 purUp4 purUp5 purUp5 purUp3 purUp3

Gene      
Name: rssA    Texpresso search in the literature
Synonym(s): ECK1229, EG12120, b1234, ychK
Genome position(nucleotides): 1289245 --> 1290150 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.22
External database links:  
ASAP:
ABE-0004144
CGSC:
37468
ECHOBASE:
EB2041
ECOLIHUB:
rssA
MIM:
612020
MIM:
245800
MIM:
215470
MIM:
275400
OU-MICROARRAY:
b1234
STRING:
511145.b1234
COLOMBOS: rssA


Product      
Name: putative patatin-like phospholipase RssA
Synonym(s): RssA, YchK
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 33.067
Isoelectric point: 6.722
Motif(s):
 
Type Positions Sequence
39 -> 43 GCSIG
155 -> 157 DGA
8 -> 165 LALGSGAARGWSHIGVINALKKVGIEIDIVAGCSIGSLVGAAYACDRLSALEDWVTSFSYWDVLRLMDLSWQRGGLLRGERVFNQYREIMPETEIENCSRRFAAVATNLSTGRELWFTEGDLHLAIRASCSIPGLMAPVAHNGYWLVDGAVVNPIPIS

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016787 - hydrolase activity
GO:0004622 - lysophospholipase activity
biological_process GO:0006629 - lipid metabolic process
GO:0016042 - lipid catabolic process
GO:0046470 - phosphatidylcholine metabolic process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-35948N
ECOCYC:
EG12120-MONOMER
ECOLIWIKI:
b1234
INTERPRO:
IPR001423
INTERPRO:
IPR002641
INTERPRO:
IPR016035
MODBASE:
P0AFR0
PFAM:
PF01734
PRIDE:
P0AFR0
PROSITE:
PS51635
PROSITE:
PS01237
REFSEQ:
NP_415750
SMR:
P0AFR0
UNIPROT:
P0AFR0


Operon      
Name: rssAB         
Operon arrangement:
Transcription unit        Promoter
rssAB
rssB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter purUp3 1288751 reverse Similarity to the consensus
Read more >
[ICWHO], [RS-EPT-CBR] [1], [2]
  promoter purUp5 1288753 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter purUp4 1288756 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_1560 1289150 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB