RegulonDB RegulonDB 10.9: Gene Form
   

hscB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

hscA hscB iscA anti-anti-terminator anti-terminator terminator hscBp hscBp TSS_2826 TSS_2826 TSS_2825 TSS_2825

Gene      
Name: hscB    Texpresso search in the literature
Synonym(s): ECK2524, EG12131, b2527, yfhE
Genome position(nucleotides): 2658952 <-- 2659467 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.33
External database links:  
ASAP:
ABE-0008317
ECHOBASE:
EB2052
ECOLIHUB:
hscB
OU-MICROARRAY:
b2527
STRING:
511145.b2527
COLOMBOS: hscB


Product      
Name: [Fe-S] cluster biosynthesis co-chaperone HscB
Synonym(s): Hsc20, Hsc20 co-chaperone that acts with Hsc66 in IscU iron-sulfur cluster assembly, HscB, YfhE, co-chaperone for [Fe-S] cluster biosynthesis
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 20.138
Isoelectric point: 4.825
Motif(s):
 
Type Positions Sequence
88 -> 161 DTAFLMEQLELREELDEIEQAKDEARLESFIKRVKKMFDTRHQLMVEQLDNETWDAAADTVRKLRFLDKLRSSA
2 -> 74 DYFTLFGLPARYQLDTQALSLRFQDLQRQYHPDKFASGSQAEQLAAVQQSATINQAWQTLRHPLMRAEYLLSL

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.19 - incorporation of metal ions
  2 - information transfer --> 2.3 - protein related --> 2.3.4 - chaperoning, repair (refolding)
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:1990230 - iron-sulfur cluster transfer complex
molecular_function GO:0005515 - protein binding
GO:0051087 - chaperone binding
GO:0001671 - ATPase activator activity
biological_process GO:0006457 - protein folding
GO:0051259 - protein complex oligomerization
GO:0032781 - positive regulation of ATPase activity
GO:0097428 - protein maturation by iron-sulfur cluster transfer
GO:0044571 - [2Fe-2S] cluster assembly
Note(s): Note(s): ...[more].
Evidence: [IDA] Inferred from direct assay
[IMP] Inferred from mutant phenotype
Reference(s): [1] Fuzery AK., et al., 2008
[2] Hoff KG., et al., 2003
[3] Hoff KG., et al., 2000
[4] Hoff KG., et al., 2002
[5] Takahashi Y., et al., 1999
[6] Tokumoto U., et al., 2004
[7] Tokumoto U., et al., 2001
External database links:  
DIP:
DIP-47847N
ECOCYC:
EG12131-MONOMER
ECOLIWIKI:
b2527
INTERPRO:
IPR001623
INTERPRO:
IPR036386
INTERPRO:
IPR036869
INTERPRO:
IPR004640
INTERPRO:
IPR009073
MODBASE:
P0A6L9
PANTHER:
PTHR14021
PDB:
1FPO
PFAM:
PF07743
PRIDE:
P0A6L9
PRODB:
PRO_000022926
PROSITE:
PS50076
REFSEQ:
NP_417022
SMART:
SM00271
SMR:
P0A6L9
UNIPROT:
P0A6L9


Operon      
Name: hscBA-fdx-iscX         
Operon arrangement:
Transcription unit        Promoter
hscBA-fdx-iscX


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2825 2658287 reverse nd [RS-EPT-CBR] [8]
  promoter TSS_2826 2658293 reverse nd [RS-EPT-CBR] [8]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Fuzery AK., Tonelli M., Ta DT., Cornilescu G., Vickery LE., Markley JL., 2008, Solution structure of the iron-sulfur cluster cochaperone HscB and its binding surface for the iron-sulfur assembly scaffold protein IscU., Biochemistry 47(36):9394-404

 [2] Hoff KG., Cupp-Vickery JR., Vickery LE., 2003, Contributions of the LPPVK motif of the iron-sulfur template protein IscU to interactions with the Hsc66-Hsc20 chaperone system., J Biol Chem 278(39):37582-9

 [3] Hoff KG., Silberg JJ., Vickery LE., 2000, Interaction of the iron-sulfur cluster assembly protein IscU with the Hsc66/Hsc20 molecular chaperone system of Escherichia coli., Proc Natl Acad Sci U S A 97(14):7790-5

 [4] Hoff KG., Ta DT., Tapley TL., Silberg JJ., Vickery LE., 2002, Hsc66 substrate specificity is directed toward a discrete region of the iron-sulfur cluster template protein IscU., J Biol Chem 277(30):27353-9

 [5] Takahashi Y., Nakamura M., 1999, Functional assignment of the ORF2-iscS-iscU-iscA-hscB-hscA-fdx-ORF3 gene cluster involved in the assembly of Fe-S clusters in Escherichia coli., J Biochem 126(5):917-26

 [6] Tokumoto U., Kitamura S., Fukuyama K., Takahashi Y., 2004, Interchangeability and distinct properties of bacterial Fe-S cluster assembly systems: functional replacement of the isc and suf operons in Escherichia coli with the nifSU-like operon from Helicobacter pylori., J Biochem (Tokyo) 136(2):199-209

 [7] Tokumoto U., Takahashi Y., 2001, Genetic analysis of the isc operon in Escherichia coli involved in the biogenesis of cellular iron-sulfur proteins., J Biochem (Tokyo) 130(1):63-71

 [8] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB