RegulonDB RegulonDB 10.8: Gene Form
   

qseG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: qseG    Texpresso search in the literature
Synonym(s): ECK2552, EG12139, b2555, yfhG
Genome position(nucleotides): 2688793 <-- 2689506 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.2
External database links:  
ASAP:
ABE-0008405
ECHOBASE:
EB2060
OU-MICROARRAY:
b2555
PortEco:
yfhG
STRING:
511145.b2555
COLOMBOS: qseG


Product      
Name: outer membrane lipoprotein QseG
Synonym(s): QseG, YfhG
Sequence: Get amino acid sequence Fasta Format
Cellular location: outer membrane,periplasmic space
Molecular weight: 27.348
Isoelectric point: 6.517
Motif(s):
 
Type Positions Sequence
26 -> 237 CVQNHNKPAIDTPAEEKIPVYQLADYLSTECSDIWALQGKSTETNPLYWLRAMDCADRLMPAQSRQQARQYDDGSWQNTFKQGILLADAKITPYERRQLVARIEALSTEIPAQVRPLYQLWRDGQALQLQLAEERQRYSKLQQSSDSELDTLRQQHHVLQQQLELTTRKLENLTDIERQLSTRKPAGNFSPDTPHESEKPAPSTHEVTPDEP
45 -> 217 VYQLADYLSTECSDIWALQGKSTETNPLYWLRAMDCADRLMPAQSRQQARQYDDGSWQNTFKQGILLADAKITPYERRQLVARIEALSTEIPAQVRPLYQLWRDGQALQLQLAEERQRYSKLQQSSDSELDTLRQQHHVLQQQLELTTRKLENLTDIERQLSTRKPAGNFSPD
1 -> 25 MRHIFQRLLPRRLWLAGLPCLALLG

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0036405 - anchored component of cell outer membrane
molecular_function GO:0005515 - protein binding
biological_process GO:0001932 - regulation of protein phosphorylation
GO:0070297 - regulation of phosphorelay signal transduction system
Note(s): Note(s): ...[more].
Evidence: [IDA] Inferred from direct assay
Reference(s): [1] Gopel Y., et al., 2018
[2] Klein G., et al., 2016
External database links:  
ECOCYC:
EG12139-MONOMER
ECOLIWIKI:
b2555
INTERPRO:
IPR025262
PFAM:
PF13942
PRIDE:
P0AD44
PROSITE:
PS51318
REFSEQ:
NP_417050
SMR:
P0AD44
UNIPROT:
P0AD44


Operon      
Name: qseG         
Operon arrangement:
Transcription unit        Promoter
yfhG


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2846 2690181 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2847 2690186 reverse nd [RS-EPT-CBR] [3]



RegulonDB