RegulonDB RegulonDB 10.9: Gene Form
   

ydhC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ydhC cfa ydhB purR ppGpp TSS_1952 TSS_1952 TSS_1951 TSS_1951 TSS_1950 TSS_1950 TSS_1949 TSS_1949 cfap2 cfap2 TSS_1948 (cluster) TSS_1948 (cluster) cfap1 cfap1 ydhCp6 ydhCp6 ydhCp1 ydhCp1 ydhCp5 ydhCp5 ydhBp2 ydhBp2

Gene      
Name: ydhC    Texpresso search in the literature
Synonym(s): ECK1656, EG12141, b1660
Genome position(nucleotides): 1739911 --> 1741122 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.38
External database links:  
ASAP:
ABE-0005551
ECHOBASE:
EB2062
ECOLIHUB:
ydhC
OU-MICROARRAY:
b1660
STRING:
511145.b1660
COLOMBOS: ydhC


Product      
Name: putative transporter YdhC
Synonym(s): YdhC, YdhC MFS transporter
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 43.367
Isoelectric point: 9.004
Motif(s):
 
Type Positions Sequence
145 -> 145 L
169 -> 169 I
299 -> 319 ILIPFCVMAIANGAIYPIVVA
384 -> 403 CEEVGCQNHGNAEVAHSESH
14 -> 341 LSVLGFLATDMYLPAFAAIQADLQTPASAVSASLSLFLAGFAAAQLLWGPLSDRYGRKPVLLIGLTIFALGSLGMLWVENAATLLVLRFVQAVGVCAAAVIWQALVTDYYPSQKVNRIFAAIMPLVGLSPALAPLLGSWLLVHFSWQAIFATLFAITVVLILPIFWLKPTTKARNNSQDGLTFTDLLRSKTYRGNVLIYAACSASFFAWLTGSPFILSEMGYSPAVIGLSYVPQTIAFLIGGYGCRAALQKWQGKQLLPWLLVLFAVSVIATWAAGFISHVSLVEILIPFCVMAIANGAIYPIVVAQALRPFPHATGRAAALQNTLQL

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.2 - Electrochemical potential driven transporters --> 4.2.A - Porters (Uni-, Sym- and Antiporters)
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0022857 - transmembrane transporter activity
GO:0042910 - xenobiotic transmembrane transporter activity
biological_process GO:1990961 - xenobiotic detoxification by transmembrane export across the plasma membrane
GO:0006855 - drug transmembrane transport
GO:0055085 - transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [1] Jindal S., et al., 2019
External database links:  
ECOCYC:
YDHC-MONOMER
ECOLIWIKI:
b1660
INTERPRO:
IPR020846
INTERPRO:
IPR011701
INTERPRO:
IPR004812
INTERPRO:
IPR036259
MODBASE:
P37597
PFAM:
PF07690
PRIDE:
P37597
PROSITE:
PS50850
REFSEQ:
YP_025306
UNIPROT:
P37597


Operon      
Name: ydhC         
Operon arrangement:
Transcription unit        Promoter
ydhC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ydhBp2 1739809 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ydhCp5 1739849 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ydhCp1 1739855 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ydhCp6 1739878 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_1948 (cluster) 1741224 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_1949 1741380 forward nd [RS-EPT-CBR] [3]
  promoter TSS_1950 1741595 forward nd [RS-EPT-CBR] [3]
  promoter TSS_1951 1741685 forward nd [RS-EPT-CBR] [3]
  promoter TSS_1952 1741975 forward nd [RS-EPT-CBR] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Jindal S., Yang L., Day PJ., Kell DB., 2019, Involvement of multiple influx and efflux transporters in the accumulation of cationic fluorescent dyes by Escherichia coli., BMC Microbiol 19(1):195

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB