RegulonDB RegulonDB 10.9: Gene Form
   

napD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

napA napG napF napD yojO napH ModE IscR FNR NarP NarL NarP NarL napFp3 napFp3 napFp2 napFp2 napFp1 napFp1

Gene      
Name: napD    Texpresso search in the literature
Synonym(s): ECK2199, EG12143, b2207, yojF
Genome position(nucleotides): 2302750 <-- 2303013 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.55
External database links:  
ASAP:
ABE-0007291
CGSC:
36547
ECHOBASE:
EB2064
ECOLIHUB:
napD
OU-MICROARRAY:
b2207
STRING:
511145.b2207
COLOMBOS: napD


Product      
Name: NapA signal peptide-binding chaperone NapD
Synonym(s): NapD, YojF, signal peptide-binding chaperone for NapA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 9.468
Isoelectric point: 3.846
Motif(s):
 
Type Positions Sequence
5 -> 81 WQVCSLVVQAKSERISDISTQLNAFPGCEVAVSDAPSGQLIVVVEAEDSETLIQTIESVRNVEGVLAVSLVYHQQEE

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.4 - chaperoning, repair (refolding)
  2 - information transfer --> 2.3 - protein related --> 2.3.5 - export, signal peptide cleavage
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0005048 - signal sequence binding
biological_process GO:0051224 - negative regulation of protein transport
Note(s): Note(s): ...[more].
Evidence: [APPH] Assay of protein purified to homogeneity
[IMP] Inferred from mutant phenotype
Reference(s): [1] Dow JM., et al., 2014
[2] Maillard J., et al., 2007
[3] Potter LC., et al., 1999
External database links:  
DIP:
DIP-46322N
ECOCYC:
NAPD-MONOMER
ECOLIWIKI:
b2207
INTERPRO:
IPR005623
MINT:
P0A9I5
PANTHER:
PTHR38603
PDB:
2PQ4
PDB:
2JSX
PFAM:
PF03927
PRIDE:
P0A9I5
PRODB:
PRO_000023348
REFSEQ:
NP_416711
SMR:
P0A9I5
UNIPROT:
P0A9I5


Operon      
Name: napFDAGHBC-ccmABCDEFGH         
Operon arrangement:
Transcription unit        Promoter
napFDAGHBC-ccmABCDEFGH
napFDAGHBC-ccmABCDEFGH
napFDAGHBC
ccmABCDEFGH


Transcriptional Regulation      
Display Regulation             
Activated by: FNR, FlhDC, NarP, ModE
Repressed by: IscR, NarL, NarP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Dow JM., Grahl S., Ward R., Evans R., Byron O., Norman DG., Palmer T., Sargent F., 2014, Characterization of a periplasmic nitrate reductase in complex with its biosynthetic chaperone., FEBS J 281(1):246-60

 [2] Maillard J., Spronk CA., Buchanan G., Lyall V., Richardson DJ., Palmer T., Vuister GW., Sargent F., 2007, Structural diversity in twin-arginine signal peptide-binding proteins., Proc Natl Acad Sci U S A 104(40):15641-6

 [3] Potter LC., Cole JA., 1999, Essential roles for the products of the napABCD genes, but not napFGH, in periplasmic nitrate reduction by Escherichia coli K-12., Biochem J 344 Pt 1:69-76


RegulonDB