RegulonDB RegulonDB 11.0: Gene Form
   

sieB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

sieB unknown ydaF kilS ydaG

Gene      
Name: sieB    Texpresso search in the literature
Synonym(s): ECK1351, EG12154, b1353
Genome position(nucleotides): 1418671 --> 1419159
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
37.22
External database links:  
ASAP:
ABE-0004540
ECHOBASE:
EB2074
ECOLIHUB:
sieB
OU-MICROARRAY:
b1353
STRING:
511145.b1353
COLOMBOS: sieB


Product      
Name: Rac prophage; phage superinfection exclusion protein
Synonym(s): SieB
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 19.244
Isoelectric point: 10.379
Motif(s):
 
Type Positions Sequence Comment
21 -> 159 MYTIIIFGLTLWLIPKEFTVAFNAYTEIPWLFQIIVFAFSFVVAISFSRLRAHIQKHYSLLPEQRVLLRLSEKEIAVFKDFLKTGNLIITSPCRNPVMKKLERKGIIQHQSDSANCSYYLVTEKYSHFMKLFWNSRSRR
22 -> 42 YTIIIFGLTLWLIPKEFTVAF UniProt: Helical.
48 -> 68 IPWLFQIIVFAFSFVVAISFS UniProt: Helical.

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
External database links:  
ALPHAFOLD:
P38392
ECOCYC:
EG12154-MONOMER
ECOLIWIKI:
b1353
INTERPRO:
IPR025982
PFAM:
PF14163
PRIDE:
P38392
PRODB:
PRO_000023949
REFSEQ:
NP_415870
UNIPROT:
P38392


Operon      
Name: sieB         
Operon arrangement:
Transcription unit        Promoter
sieB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB