RegulonDB RegulonDB 10.9: Gene Form
   

sieB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

sieB kilR unknown ydaF ydaG ydaEp5 ydaEp5

Gene      
Name: sieB    Texpresso search in the literature
Synonym(s): ECK1351, EG12154, b1353
Genome position(nucleotides): 1418671 --> 1419159 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
37.22
External database links:  
ASAP:
ABE-0004540
ECHOBASE:
EB2074
ECOLIHUB:
sieB
OU-MICROARRAY:
b1353
STRING:
511145.b1353
COLOMBOS: sieB


Product      
Name: Rac prophage; phage superinfection exclusion protein
Synonym(s): SieB
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 19.244
Isoelectric point: 10.379
Motif(s):
 
Type Positions Sequence
22 -> 42 YTIIIFGLTLWLIPKEFTVAF
21 -> 158 MYTIIIFGLTLWLIPKEFTVAFNAYTEIPWLFQIIVFAFSFVVAISFSRLRAHIQKHYSLLPEQRVLLRLSEKEIAVFKDFLKTGNLIITSPCRNPVMKKLERKGIIQHQSDSANCSYYLVTEKYSHFMKLFWNSRSR
48 -> 68 IPWLFQIIVFAFSFVVAISFS

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG12154-MONOMER
ECOLIWIKI:
b1353
INTERPRO:
IPR025982
PFAM:
PF14163
PRIDE:
P38392
PRODB:
PRO_000023949
REFSEQ:
NP_415870
UNIPROT:
P38392


Operon      
Name: sieB         
Operon arrangement:
Transcription unit        Promoter
sieB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ydaEp5 1418219 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB