RegulonDB RegulonDB 10.9: Gene Form
   

hinT gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fhuE ycfL hinT Fur Fur TSS_1435 TSS_1435 TSS_1434 TSS_1434 hinTp3 hinTp3 TSS_1433 TSS_1433 hinTp2 hinTp2 hinTp1 hinTp1 fhuEp fhuEp

Gene      
Name: hinT    Texpresso search in the literature
Synonym(s): ECK1089, EG12172, b1103, ycfF
Genome position(nucleotides): 1161885 --> 1162244 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.56
External database links:  
ASAP:
ABE-0003729
ECHOBASE:
EB2090
ECOLIHUB:
hinT
OU-MICROARRAY:
b1103
STRING:
511145.b1103
COLOMBOS: hinT


Product      
Name: purine nucleoside phosphoramidase
Synonym(s): HinT, YcfF
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 13.241
Isoelectric point: 6.135
Motif(s):
 
Type Positions Sequence
117 -> 119 KGL
114 -> 119 LAHKGL
101 -> 101 H
12 -> 109 RREIPSDIVYQDDLVTAFRDISPQAPTHILIIPNILIPTVNDVSAEHEQALGRMITVAAKIAEQEGIAEDGYRLIMNTNRHGGQEVYHIHMHLLGGRP
6 -> 115 IFSKIIRREIPSDIVYQDDLVTAFRDISPQAPTHILIIPNILIPTVNDVSAEHEQALGRMITVAAKIAEQEGIAEDGYRLIMNTNRHGGQEVYHIHMHLLGGRPLGPMLA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016787 - hydrolase activity
GO:0000166 - nucleotide binding
GO:0043530 - adenosine 5'-monophosphoramidase activity
biological_process GO:0055130 - D-alanine catabolic process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-48009N
ECOCYC:
EG12172-MONOMER
ECOLIWIKI:
b1103
INTERPRO:
IPR011146
INTERPRO:
IPR036265
INTERPRO:
IPR019808
INTERPRO:
IPR001310
MODBASE:
P0ACE7
PDB:
3N1T
PDB:
3N1S
PFAM:
PF01230
PRIDE:
P0ACE7
PRINTS:
PR00332
PRODB:
PRO_000022888
PROSITE:
PS51084
PROSITE:
PS00892
REFSEQ:
NP_415621
SMR:
P0ACE7
SWISSMODEL:
P0ACE7
UNIPROT:
P0ACE7


Operon      
Name: hinT-ycfL-lpoB-thiK-nagZ-ycfP         
Operon arrangement:
Transcription unit        Promoter
hinT-ycfL-lpoB-thiK-nagZ-ycfP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter hinTp1 1161821 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter hinTp2 1161823 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_1433 1161825 forward nd [RS-EPT-CBR] [2]
  promoter hinTp3 1161827 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_1434 1161832 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1435 1161855 forward nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB