RegulonDB RegulonDB 10.8: Gene Form
   

grxD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

lhr mepH grxD NsrR NsrR anti-terminator mepHp mepHp TSS_1936 TSS_1936 grxD grxD TSS_1935 TSS_1935 TSS_1934 (cluster) TSS_1934 (cluster) TSS_1933 TSS_1933 TSS_1932 (cluster) TSS_1932 (cluster)

Gene      
Name: grxD    Texpresso search in the literature
Synonym(s): ECK1650, EG12181, b1654, ydhD
Genome position(nucleotides): 1733754 <-- 1734101 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.59
External database links:  
ASAP:
ABE-0005527
ECHOBASE:
EB2098
MIM:
616859
MIM:
616860
OU-MICROARRAY:
b1654
PortEco:
grxD
STRING:
511145.b1654
COLOMBOS: grxD


Product      
Name: glutaredoxin 4
Synonym(s): Grx4, GrxD, YdhD
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 12.879
Isoelectric point: 4.406
Motif(s):
 
Type Positions Sequence
5 -> 107 IEKIQRQIAENPILLYMKGSPKLPSCGFSAQAVQALAACGERFAYVDILQNPDIRAELPKYANWPTFPQLWVDGELVGGCDIVIEMYQRGELQQLIKETAAKY
84 -> 85 CD
17 -> 81 ILLYMKGSPKLPSCGFSAQAVQALAACGERFAYVDILQNPDIRAELPKYANWPTFPQLWVDGELV

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.15 - large molecule carriers --> 1.6.15.2 - thioredoxin, glutaredoxin
Gene Ontology Terms (GO)  
cellular_component GO:0005623 - cell
GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0009055 - electron transfer activity
GO:0046872 - metal ion binding
GO:0051536 - iron-sulfur cluster binding
GO:0051537 - 2 iron, 2 sulfur cluster binding
GO:0015036 - disulfide oxidoreductase activity
GO:0015035 - protein disulfide oxidoreductase activity
GO:0042803 - protein homodimerization activity
biological_process GO:0045454 - cell redox homeostasis
GO:0022900 - electron transport chain
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
Reference(s): [1] Boutigny S., et al., 2013
External database links:  
DIP:
DIP-11729N
ECOCYC:
EG12181-MONOMER
ECOLIWIKI:
b1654
INTERPRO:
IPR033658
INTERPRO:
IPR036249
INTERPRO:
IPR014434
INTERPRO:
IPR004480
INTERPRO:
IPR002109
MINT:
MINT-1258030
MODBASE:
P0AC69
PANTHER:
PTHR10293
PDB:
2WCI
PDB:
1YKA
PFAM:
PF00462
PRIDE:
P0AC69
PRODB:
PRO_000022842
PROSITE:
PS51354
REFSEQ:
NP_416171
SMR:
P0AC69
UNIPROT:
P0AC69


Operon      
Name: grxD         
Operon arrangement:
Transcription unit        Promoter
grxD


Transcriptional Regulation      
Display Regulation             
Repressed by: NsrR


Regulation by small RNA    
  Display Regulation
small RNA ryhB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1932 (cluster) 1733911 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_1933 1734118 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1934 (cluster) 1734136 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_1935 1734160 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1936 1734189 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Boutigny S., Saini A., Baidoo EE., Yeung N., Keasling JD., Butland G., 2013, Physical and Functional Interactions of a Monothiol Glutaredoxin and an Iron Sulfur Cluster Carrier Protein with the Sulfur-donating Radical S-Adenosyl-L-methionine Enzyme MiaB., J Biol Chem 288(20):14200-11

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB