RegulonDB RegulonDB 10.9: Gene Form
   

grxD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

lhr mepH grxD NsrR NsrR anti-terminator mepHp mepHp TSS_1936 TSS_1936 grxD grxD TSS_1935 TSS_1935 TSS_1934 (cluster) TSS_1934 (cluster) TSS_1933 TSS_1933 TSS_1932 (cluster) TSS_1932 (cluster)

Gene      
Name: grxD    Texpresso search in the literature
Synonym(s): ECK1650, EG12181, b1654, ydhD
Genome position(nucleotides): 1733754 <-- 1734101 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.59
External database links:  
ASAP:
ABE-0005527
ECHOBASE:
EB2098
ECOLIHUB:
grxD
MIM:
616859
MIM:
616860
OU-MICROARRAY:
b1654
STRING:
511145.b1654
COLOMBOS: grxD


Product      
Name: glutaredoxin 4
Synonym(s): Grx4, GrxD, YdhD
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 12.879
Isoelectric point: 4.406
Motif(s):
 
Type Positions Sequence
5 -> 107 IEKIQRQIAENPILLYMKGSPKLPSCGFSAQAVQALAACGERFAYVDILQNPDIRAELPKYANWPTFPQLWVDGELVGGCDIVIEMYQRGELQQLIKETAAKY
84 -> 85 CD
17 -> 81 ILLYMKGSPKLPSCGFSAQAVQALAACGERFAYVDILQNPDIRAELPKYANWPTFPQLWVDGELV

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.15 - large molecule carriers --> 1.6.15.2 - thioredoxin, glutaredoxin
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0009055 - electron transfer activity
GO:0046872 - metal ion binding
GO:0051536 - iron-sulfur cluster binding
GO:0051537 - 2 iron, 2 sulfur cluster binding
GO:0015036 - disulfide oxidoreductase activity
GO:0015035 - protein disulfide oxidoreductase activity
GO:0042803 - protein homodimerization activity
biological_process GO:0022900 - electron transport chain
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
Reference(s): [1] Boutigny S., et al., 2013
External database links:  
DIP:
DIP-11729N
ECOCYC:
EG12181-MONOMER
ECOLIWIKI:
b1654
INTERPRO:
IPR033658
INTERPRO:
IPR036249
INTERPRO:
IPR014434
INTERPRO:
IPR004480
INTERPRO:
IPR002109
MODBASE:
P0AC69
PANTHER:
PTHR10293
PDB:
1YKA
PDB:
2WCI
PFAM:
PF00462
PRIDE:
P0AC69
PRODB:
PRO_000022842
PROSITE:
PS51354
REFSEQ:
NP_416171
SMR:
P0AC69
UNIPROT:
P0AC69


Operon      
Name: grxD         
Operon arrangement:
Transcription unit        Promoter
grxD


Transcriptional Regulation      
Display Regulation             
Repressed by: NsrR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1932 (cluster) 1733911 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_1933 1734118 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1934 (cluster) 1734136 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_1935 1734160 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1936 1734189 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Boutigny S., Saini A., Baidoo EE., Yeung N., Keasling JD., Butland G., 2013, Physical and Functional Interactions of a Monothiol Glutaredoxin and an Iron Sulfur Cluster Carrier Protein with the Sulfur-donating Radical S-Adenosyl-L-methionine Enzyme MiaB., J Biol Chem 288(20):14200-11

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB