RegulonDB RegulonDB 11.0: Gene Form

ptsP gene in Escherichia coli K-12 genome

Gene local context to scale (view description)

ptsP lgt rppH TSS_3131 TSS_3131 TSS_3130 TSS_3130 lgtp lgtp TSS_3129 TSS_3129 thyAp2 thyAp2 thyAp thyAp TSS_3128 (cluster) TSS_3128 (cluster)

Name: ptsP    Texpresso search in the literature
Synonym(s): ECK2825, EG12188, b2829, ygdF, ygdO
Genome position(nucleotides): 2966188 <-- 2968434
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
External database links:  

Name: phosphoenolpyruvate-protein phosphotransferase PtsP
Synonym(s): EINtr, EInitrogen, PtsP, YgdF, YgdO, enzyme INtr
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 83.716
Isoelectric point: 5.525
Type Positions Sequence Comment
128 -> 170 QQRELRQYDESEESFLVTLATQMAAILSQSQLTALFGQYRQTR UniProt: Linker; Sequence Annotation Type: region of interest.


Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.8 - metabolism of other compounds --> 1.8.3 - nitrogen metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016740 - transferase activity
GO:0016772 - transferase activity, transferring phosphorus-containing groups
GO:0046872 - metal ion binding
GO:0016301 - kinase activity
GO:0008965 - phosphoenolpyruvate-protein phosphotransferase activity
biological_process GO:0008643 - carbohydrate transport
GO:0009401 - phosphoenolpyruvate-dependent sugar phosphotransferase system
GO:0006468 - protein phosphorylation
GO:0016310 - phosphorylation
GO:0010243 - response to organonitrogen compound
Note(s): Note(s): ...[more].
Reference(s): [1] Gu P., et al., 2019
[2] Thomas MD., et al., 2021
External database links:  

Name: rppH-ptsP         
Operon arrangement:
Transcription unit        Promoter

Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3128 (cluster) 2965245 reverse nd [RS-EPT-CBR] [3]
  promoter thyAp2 2965348 reverse nd [ICWHO] [4]
  promoter TSS_3129 2966117 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3130 2967019 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3131 2967163 reverse nd [RS-EPT-CBR] [3]


 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight


 [1] Gu P., Niu H., Fan X., Gao J., Li Q., 2019, Engineering of phosphoenolpyruvate: carbohydrate phosphotransferase system increased acetate assimilation in Escherichia coli., 3 Biotech 9(3):77

 [2] Thomas MD., Ewunkem AJ., Boyd S., Williams DK., Moore A., Rhinehardt KL., Van Beveren E., Yang B., Tapia A., Han J., Harrison SH., Graves JL., 2021, Too much of a good thing: Adaption to iron (II) intoxication in Escherichia coli., Evol Med Public Health 9(1):53-67

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78
