RegulonDB RegulonDB 11.0: Gene Form
   

eutR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

eutR hemF eutK

Gene      
Name: eutR    Texpresso search in the literature
Synonym(s): ECK2432, EG12190, b2437, yfeG
Genome position(nucleotides): 2554130 <-- 2555182
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.37
External database links:  
ASAP:
ABE-0008036
ECHOBASE:
EB2107
ECOLIHUB:
eutR
OU-MICROARRAY:
b2437
STRING:
511145.b2437
COLOMBOS: eutR


Product      
Name: putative DNA-binding transcriptional regulator EutR
Synonym(s): EutR, YfeG
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 40.16
Isoelectric point: 6.839
Motif(s):
 
Type Positions Sequence Comment
243 -> 344 SRAREYVLENMSEPVTVLDLCNQLHVSRRTLQNAFHAILGIGPNAWLKRIRLNAVRRELISPWSQSMTVKDAAMQWGFWHLGQFATDYQQLFSEKPSLTLHQ UniProt: HTH araC/xylS-type.
260 -> 281 LDLCNQLHVSRRTLQNAFHAIL UniProt: H-T-H motif.
262 -> 342 LCNQLHVSRRTLQNAFHAILGIGPNAWLKRIRLNAVRRELISPWSQSMTVKDAAMQWGFWHLGQFATDYQQLFSEKPSLTL
276 -> 276 A UniProt: In Ref. 1; CAA53168..
285 -> 285 P UniProt: In Ref. 1; CAA53168..

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.4 - amines
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
GO:0043565 - sequence-specific DNA binding
biological_process GO:0006351 - transcription, DNA-templated
GO:0006355 - regulation of transcription, DNA-templated
GO:0046336 - ethanolamine catabolic process
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
Reference(s): [1] Perez-Rueda E., et al., 2000
[2] Perez-Rueda E., et al., 2004
External database links:  
ALPHAFOLD:
P36547
ECOCYC:
EG12190-MONOMER
ECOLIWIKI:
b2437
INTERPRO:
IPR018060
INTERPRO:
IPR018062
INTERPRO:
IPR009057
MODBASE:
P36547
PFAM:
PF12833
PRIDE:
P36547
PRODB:
PRO_000022549
PROSITE:
PS00041
PROSITE:
PS01124
REFSEQ:
NP_416932
SMART:
SM00342
SMR:
P36547
UNIPROT:
P36547


Operon      
Name: eutBCLKR         
Operon arrangement:
Transcription unit        Promoter
eutBCLKR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Perez-Rueda E., Collado-Vides J., 2000, The repertoire of DNA-binding transcriptional regulators in Escherichia coli K-12., Nucleic Acids Res 28(8):1838-47

 [2] Perez-Rueda E., Collado-Vides J., Segovia L., 2004, Phylogenetic distribution of DNA-binding transcription factors in bacteria and archaea., Comput Biol Chem 28(5-6):341-50


RegulonDB