RegulonDB RegulonDB 10.8: Gene Form
   

cbpM gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yccE cbpA torD cbpM torA Fis cbpAp6 cbpAp6 cbpAp4 cbpAp4 cbpAp1 cbpAp1 cbpAp2 cbpAp2 TSS_1313 TSS_1313 TSS_1312 TSS_1312

Gene      
Name: cbpM    Texpresso search in the literature
Synonym(s): ECK0990, EG12194, b0999, yccD
Genome position(nucleotides): 1062550 <-- 1062855 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.25
External database links:  
ASAP:
ABE-0003377
ECHOBASE:
EB2111
OU-MICROARRAY:
b0999
PortEco:
cbpM
STRING:
511145.b0999
COLOMBOS: cbpM


Product      
Name: chaperone modulator CbpM
Synonym(s): CbpM, YccD
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 11.512
Isoelectric point: 5.118
Motif(s):
 
Type Positions Sequence
8 -> 92 FTITEFCLHTGISEEELNEIVGLGVVEPREIQETTWVFDDHAAIVVQRAVRLRHELALDWPGIAVALTLMDDIAHLKQENRLLRQ

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.4 - chaperoning, repair (refolding)
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.3 - inhibition / activation of enzymes
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0004857 - enzyme inhibitor activity
biological_process GO:0043086 - negative regulation of catalytic activity
Note(s): Note(s): ...[more].
Evidence: [APPH] Assay of protein purified to homogeneity
Reference(s): [1] Chae C., et al., 2004
External database links:  
DIP:
DIP-47830N
ECOCYC:
EG12194-MONOMER
ECOLIWIKI:
b0999
INTERPRO:
IPR022835
PFAM:
PF13591
PRIDE:
P63264
PRODB:
PRO_000022251
REFSEQ:
NP_415519
SMR:
P63264
UNIPROT:
P63264


Operon      
Name: cbpAM         
Operon arrangement:
Transcription unit        Promoter
cbpAM
cbpAM
cbpA-cbpM
cbpA-cbpM


Transcriptional Regulation      
Display Regulation             
Repressed by: Fis


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1312 1063512 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1313 1063599 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Chae C., Sharma S., Hoskins JR., Wickner S., 2004, CbpA, a DnaJ homolog, is a DnaK co-chaperone, and its activity is modulated by CbpM., J Biol Chem 279(32):33147-53

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB