RegulonDB RegulonDB 10.9: Gene Form
   

treR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

treB treR mgtA5\' mgtL PhoP ArcA TreR CRP TreR CRP Cis-reg; riboswitch anti-terminator terminator mgtAp1 mgtAp1 TSS_5086 TSS_5086 treRp4 treRp4 TSS_5085 TSS_5085 mgtAp2 mgtAp2 treRp3 treRp3 treRp2 treRp2 treRp1 treRp1 treBp treBp

Gene      
Name: treR    Texpresso search in the literature
Synonym(s): ECK4236, EG12202, b4241
Genome position(nucleotides): 4466299 <-- 4467246 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.8
External database links:  
ASAP:
ABE-0013875
ECHOBASE:
EB2118
ECOLIHUB:
treR
OU-MICROARRAY:
b4241
STRING:
511145.b4241
COLOMBOS: treR


Shine dalgarno      
Sequence: cacgttacagGACAACagGAT


Product      
Name: DNA-binding transcriptional repressor TreR
Synonym(s): TreR
Sequence: Get amino acid sequence Fasta Format
Regulator Family: GalR/LacI
Cellular location: cytosol
Molecular weight: 34.531
Isoelectric point: 8.317
Motif(s):
 
Type Positions Sequence
6 -> 51 TIKDIARLSGVGKSTVSRVLNNESGVSQLTRERVEAVMNQHGFSPS
7 -> 26 IKDIARLSGVGKSTVSRVLN
5 -> 59 LTIKDIARLSGVGKSTVSRVLNNESGVSQLTRERVEAVMNQHGFSPSRSARAMRG
71 -> 77 RLDSLSE
168 -> 312 QRLYDQGHRNISYLGVPHSDVTTGKRRHEAYLAFCKAHKLHPVAALPGLAMKQGYENVAKVITPETTALLCATDTLALGASKYLQEQRIDTLQLASVGNTPLMKFLHPEIVTVDPGYAEAGRQAACQLIAQVTGRSEPQQIIIPA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.9 - misc. glucose metabolism
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.2 - regulon
  5 - cell processes --> 5.5 - adaptations --> 5.5.1 - osmotic pressure
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
GO:0000976 - transcription regulatory region sequence-specific DNA binding
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0045892 - negative regulation of transcription, DNA-templated
GO:0005991 - trehalose metabolic process
External database links:  
DIP:
DIP-11026N
ECOCYC:
EG12202-MONOMER
ECOLIWIKI:
b4241
INTERPRO:
IPR000843
INTERPRO:
IPR028082
INTERPRO:
IPR012771
INTERPRO:
IPR010982
MODBASE:
P36673
PDB:
4XXH
PFAM:
PF00356
PFAM:
PF13377
PRIDE:
P36673
PRINTS:
PR00036
PRODB:
PRO_000024110
PROSITE:
PS00356
PROSITE:
PS50932
REFSEQ:
NP_418662
SMART:
SM00354
SMR:
P36673
UNIPROT:
P36673


Operon      
Name: treR         
Operon arrangement:
Transcription unit        Promoter
treR
treR
treR
treR


Transcriptional Regulation      
Display Regulation             
Repressed by: PhoP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_5085 4467343 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_5086 4467362 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB